FC919304

Overview
NameFC919304
Unique NameFC919304
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length607
Libraries
Library NameType
PCRcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC919304_ssr438 microsatellite FC919304_ssr438:438..449. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig2562 contig Ccv1_Contig2562:245..854. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP1_ORYSJ (Non-specific lipid-transfer protein 1 OS=Oryza sativa subsp. japonica GN=LTP PE=1 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 2.528e-23
Identity = 51/92 (55.43%), Postives = 63/92 (68.48%), Query Frame = 1
Query:  112 AITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRV 387
            AITCGQV +++ PC+ + R GG  P   CCSGVRSL  AA TT DR+ ACNCLK A   I+G+    AA +P +CG+ +PY IS S DCSRV
Sbjct:   25 AITCGQVNSAVGPCLTYAR-GGAGPSAACCSGVRSLKAAASTTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVSVPYTISASIDCSRV 115          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP1_ORYSI (Non-specific lipid-transfer protein 1 OS=Oryza sativa subsp. indica GN=LTP PE=2 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 2.528e-23
Identity = 51/92 (55.43%), Postives = 63/92 (68.48%), Query Frame = 1
Query:  112 AITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRV 387
            AITCGQV +++ PC+ + R GG  P   CCSGVRSL  AA TT DR+ ACNCLK A   I+G+    AA +P +CG+ +PY IS S DCSRV
Sbjct:   25 AITCGQVNSAVGPCLTYAR-GGAGPSAACCSGVRSLKAAASTTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVSVPYTISASIDCSRV 115          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP3_HORVU (Non-specific lipid-transfer protein 3 OS=Hordeum vulgare GN=LTP3 PE=3 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 3.302e-23
Identity = 47/92 (51.09%), Postives = 67/92 (72.83%), Query Frame = 1
Query:  112 AITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRV 387
            AI+CGQV+++L+PCI + R  G  PP  CCSGV+ L GAA++T D+QAAC CLK    +I+GI     +G+P +CG+ +P+ IS STDC++V
Sbjct:   26 AISCGQVSSALSPCISYARGNGAKPPVACCSGVKRLAGAAQSTADKQAACRCLKSLATSIKGINMGKVSGVPGKCGVSVPFPISMSTDCNKV 117          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP_SPIOL (Non-specific lipid-transfer protein OS=Spinacia oleracea PE=1 SV=2)

HSP 1 Score: 107.842 bits (268), Expect = 4.312e-23
Identity = 51/91 (56.04%), Postives = 63/91 (69.23%), Query Frame = 1
Query:  115 ITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRV 387
            ITCG V++ LAPCI +L+ G       CC G+++LN AA TTPDR+ ACNCLK A   I+GI    AAGLP  CG+ IPY ISPST+C+ V
Sbjct:   28 ITCGMVSSKLAPCIGYLKGGPL--GGGCCGGIKALNAAAATTPDRKTACNCLKSAANAIKGINYGKAAGLPGMCGVHIPYAISPSTNCNAV 116          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP_GERHY (Non-specific lipid-transfer protein OS=Gerbera hybrida PE=3 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 5.632e-23
Identity = 51/93 (54.84%), Postives = 62/93 (66.67%), Query Frame = 1
Query:  109 NAITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRV 387
            +AI+CGQVT+ L PC  +L  GG  PP  CC+GVR LN AA+TTPDRQ AC CLK        I  N A  LP +CGI I YKI+P+ DCS++
Sbjct:   24 DAISCGQVTSGLVPCFGYLAAGGPVPPA-CCNGVRGLNNAAKTTPDRQTACGCLKGILAANTRINLNNANSLPGKCGISIGYKITPNIDCSKI 115          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP_ELECO (Non-specific lipid-transfer protein OS=Eleusine coracana PE=1 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 7.356e-23
Identity = 50/93 (53.76%), Postives = 65/93 (69.89%), Query Frame = 1
Query:  112 AITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNC-LKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRV 387
            AI+CGQV++++ PC+ + R  G  P   C SGVRSLN AARTT DR+AACNC LK A   + G+    A+ +P +CG+R+PY IS S DCSRV
Sbjct:    1 AISCGQVSSAIGPCLAYARGAGAAPSASCQSGVRSLNAAARTTADRRAACNCSLKSAASRVSGLNAGKASSIPGRCGVRLPYAISASIDCSRV 93          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP3_PRUDU (Non-specific lipid-transfer protein 3 OS=Prunus dulcis PE=2 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 1.639e-22
Identity = 51/95 (53.68%), Postives = 65/95 (68.42%), Query Frame = 1
Query:  112 AITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPN--VAAGLPXQCGIRIPYKISPSTDCSRVR 390
            A++CGQV  +L PCI ++  GG   P  CC+GVRSL   A+TT DRQ+ CNCLK+A   I     N  +AAGLP +CG+ IPYKISPSTDC  ++
Sbjct:   30 AVSCGQVVNNLTPCINYVANGGALNPS-CCTGVRSLYSLAQTTADRQSICNCLKQAVNGIPYTNANAGLAAGLPGKCGVNIPYKISPSTDCKSIK 123          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP1_ARATH (Non-specific lipid-transfer protein 1 OS=Arabidopsis thaliana GN=LTP1 PE=1 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 2.795e-22
Identity = 53/102 (51.96%), Postives = 71/102 (69.61%), Query Frame = 1
Query:  100 PVTN--AITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLK---RAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRVR 390
            P+T+  A++CG V ++LA CI ++  GG  PP  CCSGV++LN  A+TTPDRQ ACNC++   RA G+  G+    AAG+P  CG+ IPYKIS ST+C  VR
Sbjct:   20 PITSNAALSCGSVNSNLAACIGYVLQGGVIPPA-CCSGVKNLNSIAKTTPDRQQACNCIQGAARALGS--GLNAGRAAGIPKACGVNIPYKISTSTNCKTVR 118          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP_BETVU (Non-specific lipid-transfer protein OS=Beta vulgaris GN=IWF1' PE=3 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 4.768e-22
Identity = 48/96 (50.00%), Postives = 64/96 (66.67%), Query Frame = 1
Query:  100 PVTNAITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRV 387
            P+  AITCG V + LAPCI +L+ G   P   CC G++SLN AA +  DR+ AC CLK A  +I+GI    AA LP QCG+ +PY ISP+T+C+ +
Sbjct:   22 PLAEAITCGLVASKLAPCIGYLQ-GAPGPSAACCGGIKSLNSAAASPADRKTACTCLKSAATSIKGINYGKAASLPRQCGVSVPYAISPNTNCNAI 116          
BLAST of FC919304 vs. ExPASy Swiss-Prot
Match: NLTP5_VITSX (Non-specific lipid-transfer protein P5 OS=Vitis sp. PE=1 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 1.062e-21
Identity = 47/91 (51.65%), Postives = 63/91 (69.23%), Query Frame = 1
Query:  115 ITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPXQCGIRIPYKISPSTDCSRV 387
            ++CG V   LAPCI +LR+ G  P   CC+GV++L  +A TT DR+ AC CL  A  +I G+   +AAGLP +CG+ IPYKISPST+C +V
Sbjct:    1 LSCGDVATQLAPCINYLRSAGPLPVA-CCNGVKNLKNSAATTQDRRTACKCLINASKSISGVNFGLAAGLPGKCGVNIPYKISPSTNCDQV 90          
The following BLAST results are available for this feature:
BLAST of FC919304 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 80
Match NameE-valueIdentityDescription
NLTP1_ORYSJ2.528e-2355.43Non-specific lipid-transfer protein 1 OS=Oryza sat... [more]
NLTP1_ORYSI2.528e-2355.43Non-specific lipid-transfer protein 1 OS=Oryza sat... [more]
NLTP3_HORVU3.302e-2351.09Non-specific lipid-transfer protein 3 OS=Hordeum v... [more]
NLTP_SPIOL4.312e-2356.04Non-specific lipid-transfer protein OS=Spinacia ol... [more]
NLTP_GERHY5.632e-2354.84Non-specific lipid-transfer protein OS=Gerbera hyb... [more]
NLTP_ELECO7.356e-2353.76Non-specific lipid-transfer protein OS=Eleusine co... [more]
NLTP3_PRUDU1.639e-2253.68Non-specific lipid-transfer protein 3 OS=Prunus du... [more]
NLTP1_ARATH2.795e-2251.96Non-specific lipid-transfer protein 1 OS=Arabidops... [more]
NLTP_BETVU4.768e-2250.00Non-specific lipid-transfer protein OS=Beta vulgar... [more]
NLTP5_VITSX1.062e-2151.65Non-specific lipid-transfer protein P5 OS=Vitis sp... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC06055A06T7 PCR Citrus clementina cDNA clone C06055A06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC919304 ID=FC919304|Name=FC919304|organism=Citrus clementina|type=EST|length=607bp
TGATAACTAGCTATAACCAAGCAAAAGCCTCCCTGAAGAATCCTCATGGC
TGCTCTTAAGCTTGTTTGTGCTTTGCTTTTGTGCATTCTGGTGACTGCCC
CGGTGACTAATGCCATAACATGCGGGCAGGTGACAGCCTCCTTGGCTCCA
TGCATCCCTTTCTTGAGAACTGGAGGGCGTTTTCCTCCACCGCCATGCTG
TAGCGGCGTCAGGTCTCTCAACGGCGCCGCCAGAACCACCCCTGACCGCC
AAGCTGCATGCAACTGCTTGAAACGAGCTTACGGAACAATCCGCGGCATC
AAACCTAATGTTGCCGCTGGCCTTCCTANTCAATGTGGAATCAGAATTCC
TTACAAGATCAGCCCCAGCACCGACTGCTCTAGGGTCAGGTGAAGTTGAG
TTTGAGCTCTGTGACTTTCCAAGTATGATTGACTGAGAATAAATAAATAA
AGAATATCTATGTTAATTTCTTTGTCCGAACGAGTCTCCACTTGTATGAG
TTTCACTCTCATGTCATGTTTGTATATTTGCTTTTTATGTCATATTAAAT
ATGTAAACGCGATCTGTGTTTTGAGTGATTAATTATAGTTATTTTGTGGT
ATTATCT
back to top