FC920175

Overview
NameFC920175
Unique NameFC920175
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length687
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9238 contig Ccv1_Contig9238:61..748. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: Y2389_STAAR (Putative 2-hydroxyacid dehydrogenase SAR2389 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2389 PE=3 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 7.075e-15
Identity = 52/177 (29.38%), Postives = 85/177 (48.02%), Query Frame = 3
Query:  141 AIFSSAGAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVR----QGLWPINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLEAFGCCVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINKQ 650
            A+ S     V  +++    +++++    AG N+ID+   R + + + N     +   AD  +GL++ V R++   D   R     G  P+   F  G ++ GK +GI+GLG IGS VA+R  AF   V Y   N+K          Y D+  L  N+D + I  A   + HHLI+ +
Sbjct:   47 ALISLLSTNVDKDVIDAGKDLKIIANYGAGFNNIDIEYAREKSIDVTNTPKASTNATADLTIGLVLAVARRIVEGDQLSRTTGFDGWAPL---FFRGREVSGKTIGIIGLGEIGSAVARRARAFDMDVLYTGPNRKEEKEREIGAKYVDLDTLLKNADFITINAAYNPKMHHLIDTE 220          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: Y2305_STAAM (Putative 2-hydroxyacid dehydrogenase SAV2305 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2305 PE=1 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 7.075e-15
Identity = 52/177 (29.38%), Postives = 85/177 (48.02%), Query Frame = 3
Query:  141 AIFSSAGAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVR----QGLWPINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLEAFGCCVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINKQ 650
            A+ S     V  +++    +++++    AG N+ID+   R + + + N     +   AD  +GL++ V R++   D   R     G  P+   F  G ++ GK +GI+GLG IGS VA+R  AF   V Y   N+K          Y D+  L  N+D + I  A   + HHLI+ +
Sbjct:   47 ALISLLSTNVDKDVIDAGKDLKIIANYGAGFNNIDIEYAREKSIDVTNTPKASTNATADLTIGLVLAVARRIVEGDQLSRTTGFDGWAPL---FFRGREVSGKTIGIIGLGEIGSAVARRARAFDMDVLYTGPNRKEEKEREIGAKYVDLDTLLKNADFITINAAYNPKMHHLIDTE 220          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: Y2296_STAAC (Putative 2-hydroxyacid dehydrogenase SACOL2296 OS=Staphylococcus aureus (strain COL) GN=SACOL2296 PE=3 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 7.075e-15
Identity = 52/177 (29.38%), Postives = 85/177 (48.02%), Query Frame = 3
Query:  141 AIFSSAGAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVR----QGLWPINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLEAFGCCVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINKQ 650
            A+ S     V  +++    +++++    AG N+ID+   R + + + N     +   AD  +GL++ V R++   D   R     G  P+   F  G ++ GK +GI+GLG IGS VA+R  AF   V Y   N+K          Y D+  L  N+D + I  A   + HHLI+ +
Sbjct:   47 ALISLLSTNVDKDVIDAGKDLKIIANYGAGFNNIDIEYAREKSIDVTNTPKASTNATADLTIGLVLAVARRIVEGDQLSRTTGFDGWAPL---FFRGREVSGKTIGIIGLGEIGSAVARRARAFDMDVLYTGPNRKEEKEREIGAKYVDLDTLLKNADFITINAAYNPKMHHLIDTE 220          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: Y2254_STAA3 (Putative 2-hydroxyacid dehydrogenase SAUSA300_2254 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_2254 PE=3 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 7.075e-15
Identity = 52/177 (29.38%), Postives = 85/177 (48.02%), Query Frame = 3
Query:  141 AIFSSAGAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVR----QGLWPINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLEAFGCCVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINKQ 650
            A+ S     V  +++    +++++    AG N+ID+   R + + + N     +   AD  +GL++ V R++   D   R     G  P+   F  G ++ GK +GI+GLG IGS VA+R  AF   V Y   N+K          Y D+  L  N+D + I  A   + HHLI+ +
Sbjct:   47 ALISLLSTNVDKDVIDAGKDLKIIANYGAGFNNIDIEYAREKSIDVTNTPKASTNATADLTIGLVLAVARRIVEGDQLSRTTGFDGWAPL---FFRGREVSGKTIGIIGLGEIGSAVARRARAFDMDVLYTGPNRKEEKEREIGAKYVDLDTLLKNADFITINAAYNPKMHHLIDTE 220          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: Y2224_STAAW (Putative 2-hydroxyacid dehydrogenase MW2224 OS=Staphylococcus aureus (strain MW2) GN=MW2224 PE=3 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 7.075e-15
Identity = 52/177 (29.38%), Postives = 85/177 (48.02%), Query Frame = 3
Query:  141 AIFSSAGAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVR----QGLWPINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLEAFGCCVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINKQ 650
            A+ S     V  +++    +++++    AG N+ID+   R + + + N     +   AD  +GL++ V R++   D   R     G  P+   F  G ++ GK +GI+GLG IGS VA+R  AF   V Y   N+K          Y D+  L  N+D + I  A   + HHLI+ +
Sbjct:   47 ALISLLSTNVDKDVIDAGKDLKIIANYGAGFNNIDIEYAREKSIDVTNTPKASTNATADLTIGLVLAVARRIVEGDQLSRTTGFDGWAPL---FFRGREVSGKTIGIIGLGEIGSAVARRARAFDMDVLYTGPNRKEEKEREIGAKYVDLDTLLKNADFITINAAYNPKMHHLIDTE 220          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: Y2196_STAAS (Putative 2-hydroxyacid dehydrogenase SAS2196 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2196 PE=3 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 7.075e-15
Identity = 52/177 (29.38%), Postives = 85/177 (48.02%), Query Frame = 3
Query:  141 AIFSSAGAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVR----QGLWPINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLEAFGCCVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINKQ 650
            A+ S     V  +++    +++++    AG N+ID+   R + + + N     +   AD  +GL++ V R++   D   R     G  P+   F  G ++ GK +GI+GLG IGS VA+R  AF   V Y   N+K          Y D+  L  N+D + I  A   + HHLI+ +
Sbjct:   47 ALISLLSTNVDKDVIDAGKDLKIIANYGAGFNNIDIEYAREKSIDVTNTPKASTNATADLTIGLVLAVARRIVEGDQLSRTTGFDGWAPL---FFRGREVSGKTIGIIGLGEIGSAVARRARAFDMDVLYTGPNRKEEKEREIGAKYVDLDTLLKNADFITINAAYNPKMHHLIDTE 220          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: Y2098_STAAN (Putative 2-hydroxyacid dehydrogenase SA2098 OS=Staphylococcus aureus (strain N315) GN=SA2098 PE=1 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 7.075e-15
Identity = 52/177 (29.38%), Postives = 85/177 (48.02%), Query Frame = 3
Query:  141 AIFSSAGAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVR----QGLWPINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLEAFGCCVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINKQ 650
            A+ S     V  +++    +++++    AG N+ID+   R + + + N     +   AD  +GL++ V R++   D   R     G  P+   F  G ++ GK +GI+GLG IGS VA+R  AF   V Y   N+K          Y D+  L  N+D + I  A   + HHLI+ +
Sbjct:   47 ALISLLSTNVDKDVIDAGKDLKIIANYGAGFNNIDIEYAREKSIDVTNTPKASTNATADLTIGLVLAVARRIVEGDQLSRTTGFDGWAPL---FFRGREVSGKTIGIIGLGEIGSAVARRARAFDMDVLYTGPNRKEEKEREIGAKYVDLDTLLKNADFITINAAYNPKMHHLIDTE 220          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: SERA_MYCLE (D-3-phosphoglycerate dehydrogenase OS=Mycobacterium leprae GN=serA PE=3 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 7.075e-15
Identity = 55/177 (31.07%), Postives = 94/177 (53.11%), Query Frame = 3
Query:  141 AIFSSAGAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLWPINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLEAFGC-CVSYN-----SRNKKPSVTYPFYPDVCELAANSDVLIICCALTDQTHHLINKQS 653
            A+   +   V AE+L   P++++V     GL+++DV     RGV + NA        A++AL LL+   R+++ AD  +R  +W   + F  G+++ GK VG+VGLG IG  VA R+ AFG   ++Y+     +R  +  +    + D   L A +D + +    T +T  LI+K++
Sbjct:   46 ALLVRSATTVDAEVLAAAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSNIHSAAEHALALLLAASRQIAEADASLRAHIWK-RSSFS-GTEIFGKTVGVVGLGRIGQLVAARIAAFGAHVIAYDPYVAPARAAQLGIELMSFDD---LLARADFISVHLPKTPETAGLIDKEA 217          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: GRHPR_HUMAN (Glyoxylate reductase/hydroxypyruvate reductase OS=Homo sapiens GN=GRHPR PE=1 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 7.075e-15
Identity = 57/181 (31.49%), Postives = 88/181 (48.62%), Query Frame = 3
Query:  120 LHAHSVKAIFSSAGAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLWPINAEFPL-GSKLGGKRVGIVGLGSIGSEVAKRLEAFGC-CVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINK 647
            L  H  K I  +AGA            ++++   S G++H+ + E ++RG+ +    +V ++  A+ A+ LL+   R+L  A   V+ G W       L G  L    VGI+GLG IG  +A+RL+ FG     Y  R  +P     F   +    ELAA SD +++ C+LT  T  L NK
Sbjct:   59 LSDHVDKRILDAAGA-----------NLKVISTMSVGIDHLALDEIKKRGIRVGYTPDVLTDTTAELAVSLLLTTCRRLPEAIEEVKNGGWTSWKPLWLCGYGLTQSTVGIIGLGRIGQAIARRLKPFGVQRFLYTGRQPRPEEAAEFQAEFVSTPELAAQSDFIVVACSLTPATEGLCNK 228          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: Y2178_STAAB (Putative 2-hydroxyacid dehydrogenase SAB2178 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB2178 PE=3 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 9.240e-15
Identity = 51/177 (28.81%), Postives = 85/177 (48.02%), Query Frame = 3
Query:  141 AIFSSAGAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVR----QGLWPINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLEAFGCCVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINKQ 650
            A+ S     V  +++    +++++    AG N+ID+   R + + + N     +   AD  +GL++ + R++   D   R     G  P+   F  G ++ GK +GI+GLG IGS VA+R  AF   V Y   N+K          Y D+  L  N+D + I  A   + HHLI+ +
Sbjct:   47 ALISLLSTNVDKDVIDAGKDLKIIANYGAGFNNIDIEYAREKSIDVTNTPKASTNATADLTIGLVLAIARRIVEGDQLSRTTGFDGWAPL---FFRGREVSGKTIGIIGLGEIGSAVARRARAFDMDVLYTGPNRKEEKEREIGAKYVDLDTLLKNADFITINAAYNPKMHHLIDTE 220          
The following BLAST results are available for this feature:
BLAST of FC920175 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 100
Match NameE-valueIdentityDescription
Y2389_STAAR7.075e-1529.38Putative 2-hydroxyacid dehydrogenase SAR2389 OS=St... [more]
Y2305_STAAM7.075e-1529.38Putative 2-hydroxyacid dehydrogenase SAV2305 OS=St... [more]
Y2296_STAAC7.075e-1529.38Putative 2-hydroxyacid dehydrogenase SACOL2296 OS=... [more]
Y2254_STAA37.075e-1529.38Putative 2-hydroxyacid dehydrogenase SAUSA300_2254... [more]
Y2224_STAAW7.075e-1529.38Putative 2-hydroxyacid dehydrogenase MW2224 OS=Sta... [more]
Y2196_STAAS7.075e-1529.38Putative 2-hydroxyacid dehydrogenase SAS2196 OS=St... [more]
Y2098_STAAN7.075e-1529.38Putative 2-hydroxyacid dehydrogenase SA2098 OS=Sta... [more]
SERA_MYCLE7.075e-1531.07D-3-phosphoglycerate dehydrogenase OS=Mycobacteriu... [more]
GRHPR_HUMAN7.075e-1531.49Glyoxylate reductase/hydroxypyruvate reductase OS=... [more]
Y2178_STAAB9.240e-1528.81Putative 2-hydroxyacid dehydrogenase SAB2178 OS=St... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32005A03EF RVDevelop1 Citrus clementina cDNA clone C32005A03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920175 ID=FC920175|Name=FC920175|organism=Citrus clementina|type=EST|length=687bp
GGCTACTCTTAAGAAAACCATCAGGCTTCGCTATGTTAGGAGAACAGTTC
TTTACCTCAAACAAATTCCAATACTTGAAAGCATACGAATCAGCGCTTCC
TCTACACGAATTCTTGACACTACACGCGCACTCAGTGAAGGCCATCTTCT
CCAGCGCAGGTGCGCCGGTTACAGCCGAAATCCTCCGCCTGCTTCCAGAG
GTGCGGCTGGTGGTTGCCACAAGCGCCGGCCTTAACCATATTGACGTAGT
AGAGTGCCGCCGCCGCGGTGTGGCTCTGGCCAATGCTGGTAACGTTTTCT
CTGAAGACGTGGCTGATTACGCACTGGGCTTGCTAATTGATGTCCTGAGA
AAACTTTCTGCTGCCGATTGCTTTGTCAGACAAGGGCTTTGGCCTATCAA
CGCTGAATTTCCGCTTGGGTCTAAGTTGGGTGGCAAACGAGTTGGGATTG
TTGGGCTGGGGAGCATTGGGTCTGAAGTTGCCAAAAGGCTTGAAGCTTTC
GGCTGCTGCGTTTCATACAACTCTAGGAATAAAAAGCCTTCTGTTACGTA
CCCTTTCTATCCGGATGTCTGTGAACTTGCAGCTAACAGTGATGTCCTCA
TCATTTGCTGTGCATTGACTGATCAAACACATCACTTGATCAATAAGCAG
TCTTGTTGGCCCTGGGGAAAGAAGGAGTTATTATTAA
back to top