FC920175

Overview
NameFC920175
Unique NameFC920175
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length687
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9238 contig Ccv1_Contig9238:61..748. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: Y1888_STAEQ (Putative 2-hydroxyacid dehydrogenase SERP1888 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP1888 PE=3 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.576e-14
Identity = 52/177 (29.38%), Postives = 84/177 (47.46%), Query Frame = 3
Query:  141 AIFSSAGAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVR----QGLWPINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLEAFGCCVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINKQ 650
            A+ S     V  +I+     ++++    AG N+IDV   R++ + + N  +  +   AD  +GL++ V R++   D   R     G  P+   F  G ++ GK +GI+GLG IG  VAKR  AF   V Y   ++K          Y D+  L  N+D + I  A     HH+I+ +
Sbjct:   47 ALISLLSTSVDKDIIDSANNLKIIANYGAGFNNIDVEYARQQNIDVTNTPHASTNATADLTIGLILSVARRIVEGDHLSRTTGFDGWAPL---FFRGREVSGKTIGIIGLGEIGGAVAKRARAFDMDVLYTGPHRKEEKERDIGAKYVDLDTLLKNADFITINAAYNPSLHHMIDTE 220          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: Y1879_STAES (Putative 2-hydroxyacid dehydrogenase SE_1879 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1879 PE=3 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.576e-14
Identity = 53/183 (28.96%), Postives = 90/183 (49.18%), Query Frame = 3
Query:  123 HAHSVKAIFSSAGAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVR----QGLWPINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLEAFGCCVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINKQ 650
            HA ++ ++ S++   V  +I+     ++++    AG N+IDV   R++ + + N  +  +   AD  +GL++ V R++   D   R     G  P+   F  G ++ GK +GI+GLG IG  VAKR  AF   V Y   ++K          Y D+  L  N+D + I  A     HH+I+ +
Sbjct:   44 HADALVSLLSTS---VDKDIIDSANNLKIIANYGAGFNNIDVEYARQQNIDVTNTPHASTNATADLTIGLILSVARRIVEGDHLSRTTGFDGWAPL---FFRGREVSGKTIGIIGLGEIGGAVAKRARAFDMDVLYTGPHRKEEKERDIGAKYVDLDTLLKNADFITINAAYNPSLHHMIDTE 220          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: GRHPR_MOUSE (Glyoxylate reductase/hydroxypyruvate reductase OS=Mus musculus GN=Grhpr PE=1 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.688e-14
Identity = 51/156 (32.69%), Postives = 83/156 (53.21%), Query Frame = 3
Query:  201 VRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLWPINAEFPL---GSKLGGKRVGIVGLGSIGSEVAKRLEAFGC-CVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINK 647
            +R++   S G++H+ + E ++RG+ +     V ++  A+ A+ LL+   R+L  A   V+ G W  ++  PL   G  L    VGIVGLG IG  +A+RL+ FG     Y  R  +P     F   +  + +LAA SD +++ C+LT  T  L +K
Sbjct:   75 LRVISTLSVGVDHLALDEIKKRGIRVGYTPGVLTDATAELAVSLLLTTCRRLPEAIEEVKNGGW--SSWSPLWMCGYGLSQSTVGIVGLGRIGQAIARRLKPFGVQRFLYTGRQPRPQEAAEFQAEFVPIAQLAAESDFIVVSCSLTPDTMGLCSK 228          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: Y752_STAHJ (Putative 2-hydroxyacid dehydrogenase SH0752 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH0752 PE=3 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 3.511e-14
Identity = 50/174 (28.74%), Postives = 82/174 (47.13%), Query Frame = 3
Query:  141 AIFSSAGAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVR-QGLWPINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLEAFGCCVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINKQ 650
            A+ S     V  E++     ++++    AG N++DV   R + + + N     +   A+   GL++ V R++   D   R QG       F  G ++ GK +GI+GLG IGS VAKR +AF   + Y   ++K          Y D+  L  N+D + I  A     HH+I+ +
Sbjct:   47 ALISILSTNVDQEVIDSASNLKIIANYGAGFNNVDVKYAREKDIDVTNTPKASTASTAELTFGLVLAVARRIVEGDKLSRTQGFDGWAPLFFRGREVSGKTIGIIGLGEIGSAVAKRAKAFDMDILYTGPHQKKEKEREIGAKYVDLNTLLENADFITINAAYNPDLHHMIDTE 220          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: SERA_ARCFU (D-3-phosphoglycerate dehydrogenase OS=Archaeoglobus fulgidus GN=serA PE=3 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.743e-13
Identity = 51/174 (29.31%), Postives = 91/174 (52.30%), Query Frame = 3
Query:  138 KAIFSSAGAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLWPINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLEAFGCCV----SYNSRNKKPSVTYPFYPDVCELAANSDVLIICCALTDQTHHLINK 647
            +AI   +   V AE+++    ++++     G+++ID+    +RG+ + NA    +   A++A+ L++   RK+  AD  V++G W    +F +G +L GK  G++GLG +G EVAKR +A    V     + S+ +   +      D   L A+SDV+ +    T +T  LI K
Sbjct:   43 EAIVVRSQTKVDAEVIQAAKNLKIIGRAGVGVDNIDINAATQRGIVVVNAPGGNTISTAEHAIALMLAAARKIPQADRSVKEGKWE-RKKF-MGIELRGKTAGVIGLGRVGFEVAKRCKALEMNVLAYDPFVSKERAEQIGVKLV-DFDTLLASSDVITVHVPRTKETIGLIGK 213          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: GHRB_KLEP3 (Glyoxylate/hydroxypyruvate reductase B OS=Klebsiella pneumoniae (strain 342) GN=ghrB PE=3 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.743e-13
Identity = 51/166 (30.72%), Postives = 83/166 (50.00%), Query Frame = 3
Query:  168 VTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLW--PINAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLE-AFGCCVSYNSRNKKPSVTYPF---YPDVCELAANSDVLIICCALTDQTHHLINK 647
            V A +L  +P++R     S G ++ DV     R V L +   V +E VAD  + L++   R++      V+ G W   I  ++  GS +  K +GIVG+G IG  +A+R    FG  + YN+R + P     F   Y D+  L   +D + +   L+++THHL  +
Sbjct:   56 VDAALLEKMPKLRATSTVSVGYDNFDVEALNARRVLLMHTPTVLTETVADTVMALVLSTARRVVEVAERVKAGEWTKSIGPDW-FGSDVHHKTLGIVGMGRIGMALAQRAHFGFGMPILYNARRQHPQAEERFNARYCDLDTLLQEADFVCLILPLSEETHHLFGQ 220          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: GHRB_YERPY (Glyoxylate/hydroxypyruvate reductase B OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=ghrB PE=3 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 2.276e-13
Identity = 50/170 (29.41%), Postives = 83/170 (48.82%), Query Frame = 3
Query:  156 AGAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLWPIN-AEFPLGSKLGGKRVGIVGLGSIGSEVAKRLE-AFGCCVSYNSRNKKPSVTYPFYPDVCE---LAANSDVLIICCALTDQTHHLINKQ 650
            +G  +  + L+L P +R     S G ++ DV    +RG+AL +   V +E VAD  + L++   R++      V+ G W  +  +   G  +  K +GI+G+G IG  +A+R    F   V Y SR    +    F    C    L A +D L I   +T+QT+H+I ++
Sbjct:   52 SGGKIDQDFLQLAPNLRAASTISVGYDNFDVEALSQRGIALMHTPTVLTETVADTMMALMLSTARRVVELAERVKAGEWQESIGDDWFGVDVHHKTIGILGMGRIGMALAQRAHFGFSMPVLYTSRRPHEAAEQRFGARHCSLDTLLAEADFLCITLPMTEQTYHMIGRE 221          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: GHRB_YERPS (Glyoxylate/hydroxypyruvate reductase B OS=Yersinia pseudotuberculosis GN=ghrB PE=3 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 2.276e-13
Identity = 50/170 (29.41%), Postives = 83/170 (48.82%), Query Frame = 3
Query:  156 AGAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLWPIN-AEFPLGSKLGGKRVGIVGLGSIGSEVAKRLE-AFGCCVSYNSRNKKPSVTYPFYPDVCE---LAANSDVLIICCALTDQTHHLINKQ 650
            +G  +  + L+L P +R     S G ++ DV    +RG+AL +   V +E VAD  + L++   R++      V+ G W  +  +   G  +  K +GI+G+G IG  +A+R    F   V Y SR    +    F    C    L A +D L I   +T+QT+H+I ++
Sbjct:   52 SGGKIDQDFLQLAPNLRAASTISVGYDNFDVEALSQRGIALMHTPTVLTETVADTMMALMLSTARRVVELAERVKAGEWQESIGDDWFGVDVHHKTIGILGMGRIGMALAQRAHFGFSMPVLYTSRRPHEAAEQRFGARHCSLDTLLAEADFLCITLPMTEQTYHMIGRE 221          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: GHRB_YERPP (Glyoxylate/hydroxypyruvate reductase B OS=Yersinia pestis (strain Pestoides F) GN=ghrB PE=3 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 2.276e-13
Identity = 50/170 (29.41%), Postives = 83/170 (48.82%), Query Frame = 3
Query:  156 AGAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLWPIN-AEFPLGSKLGGKRVGIVGLGSIGSEVAKRLE-AFGCCVSYNSRNKKPSVTYPFYPDVCE---LAANSDVLIICCALTDQTHHLINKQ 650
            +G  +  + L+L P +R     S G ++ DV    +RG+AL +   V +E VAD  + L++   R++      V+ G W  +  +   G  +  K +GI+G+G IG  +A+R    F   V Y SR    +    F    C    L A +D L I   +T+QT+H+I ++
Sbjct:   52 SGGKIDQDFLQLAPNLRAASTISVGYDNFDVEALSQRGIALMHTPTVLTETVADTMMALMLSTARRVVELAERVKAGEWQESIGDDWFGVDVHHKTIGILGMGRIGMALAQRAHFGFSMPVLYTSRRPHEAAEQRFGARHCSLDTLLAEADFLCITLPMTEQTYHMIGRE 221          
BLAST of FC920175 vs. ExPASy Swiss-Prot
Match: GHRB_YERPN (Glyoxylate/hydroxypyruvate reductase B OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=ghrB PE=3 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 2.276e-13
Identity = 50/170 (29.41%), Postives = 83/170 (48.82%), Query Frame = 3
Query:  156 AGAPVTAEILRLLPEVRLVVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLWPIN-AEFPLGSKLGGKRVGIVGLGSIGSEVAKRLE-AFGCCVSYNSRNKKPSVTYPFYPDVCE---LAANSDVLIICCALTDQTHHLINKQ 650
            +G  +  + L+L P +R     S G ++ DV    +RG+AL +   V +E VAD  + L++   R++      V+ G W  +  +   G  +  K +GI+G+G IG  +A+R    F   V Y SR    +    F    C    L A +D L I   +T+QT+H+I ++
Sbjct:   52 SGGKIDQDFLQLAPNLRAASTISVGYDNFDVEALSQRGIALMHTPTVLTETVADTMMALMLSTARRVVELAERVKAGEWQESIGDDWFGVDVHHKTIGILGMGRIGMALAQRAHFGFSMPVLYTSRRPHEAAEQRFGARHCSLDTLLAEADFLCITLPMTEQTYHMIGRE 221          
The following BLAST results are available for this feature:
BLAST of FC920175 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 100
Match NameE-valueIdentityDescription
Y1888_STAEQ1.576e-1429.38Putative 2-hydroxyacid dehydrogenase SERP1888 OS=S... [more]
Y1879_STAES1.576e-1428.96Putative 2-hydroxyacid dehydrogenase SE_1879 OS=St... [more]
GRHPR_MOUSE2.688e-1432.69Glyoxylate reductase/hydroxypyruvate reductase OS=... [more]
Y752_STAHJ3.511e-1428.74Putative 2-hydroxyacid dehydrogenase SH0752 OS=Sta... [more]
SERA_ARCFU1.743e-1329.31D-3-phosphoglycerate dehydrogenase OS=Archaeoglobu... [more]
GHRB_KLEP31.743e-1330.72Glyoxylate/hydroxypyruvate reductase B OS=Klebsiel... [more]
GHRB_YERPY2.276e-1329.41Glyoxylate/hydroxypyruvate reductase B OS=Yersinia... [more]
GHRB_YERPS2.276e-1329.41Glyoxylate/hydroxypyruvate reductase B OS=Yersinia... [more]
GHRB_YERPP2.276e-1329.41Glyoxylate/hydroxypyruvate reductase B OS=Yersinia... [more]
GHRB_YERPN2.276e-1329.41Glyoxylate/hydroxypyruvate reductase B OS=Yersinia... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32005A03EF RVDevelop1 Citrus clementina cDNA clone C32005A03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920175 ID=FC920175|Name=FC920175|organism=Citrus clementina|type=EST|length=687bp
GGCTACTCTTAAGAAAACCATCAGGCTTCGCTATGTTAGGAGAACAGTTC
TTTACCTCAAACAAATTCCAATACTTGAAAGCATACGAATCAGCGCTTCC
TCTACACGAATTCTTGACACTACACGCGCACTCAGTGAAGGCCATCTTCT
CCAGCGCAGGTGCGCCGGTTACAGCCGAAATCCTCCGCCTGCTTCCAGAG
GTGCGGCTGGTGGTTGCCACAAGCGCCGGCCTTAACCATATTGACGTAGT
AGAGTGCCGCCGCCGCGGTGTGGCTCTGGCCAATGCTGGTAACGTTTTCT
CTGAAGACGTGGCTGATTACGCACTGGGCTTGCTAATTGATGTCCTGAGA
AAACTTTCTGCTGCCGATTGCTTTGTCAGACAAGGGCTTTGGCCTATCAA
CGCTGAATTTCCGCTTGGGTCTAAGTTGGGTGGCAAACGAGTTGGGATTG
TTGGGCTGGGGAGCATTGGGTCTGAAGTTGCCAAAAGGCTTGAAGCTTTC
GGCTGCTGCGTTTCATACAACTCTAGGAATAAAAAGCCTTCTGTTACGTA
CCCTTTCTATCCGGATGTCTGTGAACTTGCAGCTAACAGTGATGTCCTCA
TCATTTGCTGTGCATTGACTGATCAAACACATCACTTGATCAATAAGCAG
TCTTGTTGGCCCTGGGGAAAGAAGGAGTTATTATTAA
back to top