FC920184

Overview
NameFC920184
Unique NameFC920184
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length685
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9464 contig Ccv1_Contig9464:16..700. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920184 vs. ExPASy Swiss-Prot
Match: FADB_SHEHH (Fatty acid oxidation complex subunit alpha OS=Shewanella halifaxensis (strain HAW-EB4) GN=fadB PE=3 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.633e-11
Identity = 43/132 (32.58%), Postives = 63/132 (47.73%), Query Frame = 1
Query:  286 NALGTDMLRGLKHAFETISEDSSANVVMIRSSVPKVFCAGADLKERRQMSPSE---IHFYVNTLRSTFSFLEALPIPTIAVIDXXXXXXXXXXXXXCDLRICGEAALLGLPETGLAIIPGAGGTQRLSKIXG 672
            N    + +  L  A ++I +D+S   +M+ SS    F  GAD+ E   +   E   +  ++      F+ LE LP PT++ I+              D RI    A +GLPET L IIPG GGT RL ++ G
Sbjct:   29 NKFDRETIDSLNAALDSIKQDTSIKALML-SSAKDAFIVGADITEFLGLFAEEDAVLQSWLEQANVVFNKLEDLPFPTLSAINGFALGAGCETILATDFRIADTTARIGLPETKLGIIPGFGGTVRLPRVIG 159          
BLAST of FC920184 vs. ExPASy Swiss-Prot
Match: ECHM_PONAB (Enoyl-CoA hydratase, mitochondrial OS=Pongo abelii GN=ECHS1 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 6.198e-11
Identity = 42/133 (31.58%), Postives = 63/133 (47.37%), Query Frame = 1
Query:  286 NALGTDMLRGLKHAFETISEDSSANVVMIRSSVPKVFCAGADLKERRQMSPSEIHFYVNTLRSTFSFLEALPIPTIAVIDXXXXXXXXXXXXXCDLRICGEAALLGLPETGLAIIPGAGGTQRLSKIXGKSVA 684
            NAL   ++  L  A +   ED +   +++     K F AGAD+KE + +S  +   Y +     +  L  +  P IA ++             CD+   GE A    PE  +  IPGAGGTQRL++  GKS+A
Sbjct:   59 NALCDGLIDELNQALKIFEEDPAVGAIVLTGG-DKAFAAGADIKEMQNLSFQDC--YSSKFLKHWDHLTQIKKPVIAAVNGYAFGGGCELAMMCDIIYAGEKAQFAQPEILIGTIPGAGGTQRLTRTVGKSLA 188          
BLAST of FC920184 vs. ExPASy Swiss-Prot
Match: ECHM_CAEEL (Probable enoyl-CoA hydratase, mitochondrial OS=Caenorhabditis elegans GN=ech-6 PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 6.198e-11
Identity = 44/134 (32.84%), Postives = 65/134 (48.51%), Query Frame = 1
Query:  286 NALGTDMLRGLKHAFETISEDSSANVVMIRSSVPKVFCAGADLKERRQMSPSEIHF-YVNTLRSTFSFLEALPIPTIAVIDXXXXXXXXXXXXXCDLRICGEAALLGLPETGLAIIPGAGGTQRLSKIXGKSVA 684
            NAL   ++  L  A E +  D S   ++I  S  + F AGAD+KE   M+ +E    +  +  S ++ +  +  P IA ++             CD+   GE A  G PE  +  IPGAGGTQR ++  GKS A
Sbjct:   57 NALCAQLMTELADALEVLDTDKSVGAIVITGS-ERAFAAGADIKE---MTNNEFATTFSGSFLSNWTAVSDVKKPVIAAVNGFALGGGNELAMMCDIIYAGEKARFGQPEINIGTIPGAGGTQRWARAAGKSFA 186          
BLAST of FC920184 vs. ExPASy Swiss-Prot
Match: ECHA8_MYCTU (Probable enoyl-CoA hydratase echA8 OS=Mycobacterium tuberculosis GN=echA8 PE=1 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 8.094e-11
Identity = 40/133 (30.08%), Postives = 66/133 (49.62%), Query Frame = 1
Query:  286 NALGTDMLRGLKHAFETISEDSSANVVMIRSSVPKVFCAGADLKERRQMSPSEIHFYVNTLRSTFSFLEALPIPTIAVIDXXXXXXXXXXXXXCDLRICGEAALLGLPETGLAIIPGAGGTQRLSKIXGKSVA 684
            NAL + ++  +  A   + +D     ++I  S  K F AGAD+KE   ++ ++   +     +T+  L A+  PTIA +              CD+ I  + A  G PE  L ++PG GG+QRL++  GK+ A
Sbjct:   26 NALNSQVMNEVTSAATELDDDPDIGAIIITGSA-KAFAAGADIKEMADLTFADA--FTADFFATWGKLAAVRTPTIAAVAGYALGGGCELAMMCDVLIAADTAKFGQPEIKLGVLPGMGGSQRLTRAIGKAKA 155          
BLAST of FC920184 vs. ExPASy Swiss-Prot
Match: ECHA8_MYCBO (Probable enoyl-CoA hydratase echA8 OS=Mycobacterium bovis GN=echA8 PE=3 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 8.094e-11
Identity = 40/133 (30.08%), Postives = 66/133 (49.62%), Query Frame = 1
Query:  286 NALGTDMLRGLKHAFETISEDSSANVVMIRSSVPKVFCAGADLKERRQMSPSEIHFYVNTLRSTFSFLEALPIPTIAVIDXXXXXXXXXXXXXCDLRICGEAALLGLPETGLAIIPGAGGTQRLSKIXGKSVA 684
            NAL + ++  +  A   + +D     ++I  S  K F AGAD+KE   ++ ++   +     +T+  L A+  PTIA +              CD+ I  + A  G PE  L ++PG GG+QRL++  GK+ A
Sbjct:   26 NALNSQVMNEVTSAATELDDDPDIGAIIITGSA-KAFAAGADIKEMADLTFADA--FTADFFATWGKLAAVRTPTIAAVAGYALGGGCELAMMCDVLIAADTAKFGQPEIKLGVLPGMGGSQRLTRAIGKAKA 155          
The following BLAST results are available for this feature:
BLAST of FC920184 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
FADB_SHEHH3.633e-1132.58Fatty acid oxidation complex subunit alpha OS=Shew... [more]
ECHM_PONAB6.198e-1131.58Enoyl-CoA hydratase, mitochondrial OS=Pongo abelii... [more]
ECHM_CAEEL6.198e-1132.84Probable enoyl-CoA hydratase, mitochondrial OS=Cae... [more]
ECHA8_MYCTU8.094e-1130.08Probable enoyl-CoA hydratase echA8 OS=Mycobacteriu... [more]
ECHA8_MYCBO8.094e-1130.08Probable enoyl-CoA hydratase echA8 OS=Mycobacteriu... [more]

Pages

back to top
Libraries
Library NameType
RVDevelop1cdna_library
Properties
Property NameValue
Genbank descriptionC32005A12EF RVDevelop1 Citrus clementina cDNA clone C32005A12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920184 ID=FC920184|Name=FC920184|organism=Citrus clementina|type=EST|length=685bp
ATCAATTTTTCGTCACAATGAGTGCTTTAACGAAGCTAACGAAAACACTT
GCACATCACTGCGTCAAAAAATCTAAAACCCATTGGTGCAAACCTGCGCA
GCCACTTTTAAATTTATTAATCTCTGAAAATATTGTTAACATCAACACTT
CTCAGTTTCATCAGTACCAAAGCCGTAGAACTCTCATTCTAGATTCCGCT
TCCTCCGAATCTGTCCAGCTTCAGCGAATCTCCGATTCTGATATCGGAAT
AATTGAGGTTAGTTTAAACAGACCTGCGGCAAAAAAATGCGCTTGGAACG
GATATGTTGAGAGGCTTAAAGCATGCATTTGAAACTATCAGTGAGGATTC
CTCTGCTAATGTTGTCATGATACGTAGCTCGGTTCCTAAAGTGTTCTGTG
CTGGAGCTGATTTGAAGGAACGCAGGCAAATGAGTCCATCTGAGATTCAT
TTTTATGTCAACACATTGCGATCTACATTCTCCTTCTTAGAGGCACTTCC
TATTCCAACCATTGCTGTTATTGATGGAGCAGCATTGGGTGGTGGACTTG
AAATGGCACTAGCATGTGATCTTCGCATCTGTGGAGAAGCAGCACTATTG
GGCTTGCCTGAAACAGGACTTGCTATAATTCCTGGGGCGGGTGGGACACA
GCGGCTTTCAAAGATAGNTGGAAAATCAGTAGCAA
back to top