FC920403

Overview
NameFC920403
Unique NameFC920403
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length689
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:6..695. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHSB_PETHY (Chalcone synthase B OS=Petunia hybrida GN=CHSB PE=2 SV=1)

HSP 1 Score: 272.322 bits (695), Expect = 1.148e-78
Identity = 126/173 (72.83%), Postives = 151/173 (87.28%), Query Frame = 2
Query:   80 AQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            AQRA+GPA +LAIGTATP H V+Q  YPDYYFR+T S+H+ +LKEKF+R+C K+MIKKR+M+LTEE+L++NP +C++  PSLD RQDI+V E+PKLGKEAA KAI EWGQPKS ITHL+FCT SGVDMPGAD QL KL+GL PSV+R MMYQQGCFAGGT+LRLAKDLAEN +
Sbjct:   13 AQRAEGPAKILAIGTATPFHWVDQNSYPDYYFRVTNSQHLVDLKEKFRRICSKTMIKKRHMFLTEELLRKNPTLCSHNEPSLDIRQDILVSEIPKLGKEAALKAIGEWGQPKSTITHLVFCTRSGVDMPGADCQLVKLLGLSPSVQRLMMYQQGCFAGGTMLRLAKDLAENNK 185          

HSP 2 Score: 42.743 bits (99), Expect = 1.148e-78
Identity = 17/30 (56.67%), Postives = 27/30 (90.00%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLV 681
            +KGARVLVVC+E +A+ FRGP++ ++D+L+
Sbjct:  184 NKGARVLVVCAESSAIGFRGPSEANVDNLI 213          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: DPS1_PINST (Pinosylvin synthase 1 OS=Pinus strobus GN=STS1 PE=1 SV=1)

HSP 1 Score: 253.832 bits (647), Expect = 8.053e-77
Identity = 119/180 (66.11%), Postives = 152/180 (84.44%), Query Frame = 2
Query:   62 VQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYM-APSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            ++  R +QRADG A++LAIGTA P + V+Q+ YPDYYFR+T +E  T+LK+KFKR+C++S IKKR+MYLTEEILK+NP +CA++  PSLD RQ ++  EVP+LGKEAA KAI+EWGQPKS+ITHLIFCTT+  D+PGAD+++ KL+GL PSVKR  ++Q GCFAGGTVLRLAKDLAEN R
Sbjct:    9 LEAFRKSQRADGFASILAIGTANPPNVVDQSTYPDYYFRVTNNEDNTDLKDKFKRICERSAIKKRHMYLTEEILKKNPELCAFLEVPSLDTRQAMLAAEVPRLGKEAAEKAIEEWGQPKSRITHLIFCTTTTPDLPGADFEVAKLLGLHPSVKRVGVFQHGCFAGGTVLRLAKDLAENNR 188          

HSP 2 Score: 55.0694 bits (131), Expect = 8.053e-77
Identity = 25/31 (80.65%), Postives = 29/31 (93.55%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            ++GARVLVVCSE TAVTFRGP++THLD LVG
Sbjct:  187 NRGARVLVVCSENTAVTFRGPSETHLDGLVG 217          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: DPS2_PINST (Pinosylvin synthase 2 OS=Pinus strobus GN=STS2 PE=2 SV=1)

HSP 1 Score: 253.062 bits (645), Expect = 1.370e-76
Identity = 120/180 (66.67%), Postives = 152/180 (84.44%), Query Frame = 2
Query:   62 VQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYM-APSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            ++  R +QRADG A++LAIGTA P + V+Q+ YPDYYFR T +E  T+LK+KFKR+C++S IKKR+MYLTEEILK+NP +CA++  PSLD RQ ++ VEVP+LGKEAA KAI+EWGQPKS+ITHLIFCTT+  D+PGAD+++ KL+GL PSVKR  ++Q GCFAGGTVLRLAKDLAEN R
Sbjct:    9 LEAFRKSQRADGFASILAIGTANPPNVVDQSTYPDYYFRNTNNEDNTDLKDKFKRICERSAIKKRHMYLTEEILKKNPELCAFLEVPSLDTRQAMLAVEVPRLGKEAAEKAIEEWGQPKSRITHLIFCTTTTPDLPGADFEVAKLLGLHPSVKRVGVFQHGCFAGGTVLRLAKDLAENNR 188          

HSP 2 Score: 55.0694 bits (131), Expect = 1.370e-76
Identity = 25/31 (80.65%), Postives = 29/31 (93.55%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            ++GARVLVVCSE TAVTFRGP++THLD LVG
Sbjct:  187 NRGARVLVVCSENTAVTFRGPSETHLDGLVG 217          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: DPSS_PINSY (Dihydropinosylvin synthase OS=Pinus sylvestris PE=1 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 6.744e-76
Identity = 118/176 (67.05%), Postives = 151/176 (85.80%), Query Frame = 2
Query:   74 RNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYM-APSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            R  QRADG A++LAIGTA P ++V+Q+ YPD+YFRIT +EH TELK+KFKR+C++S IK+RYMYLTEEILK+NP++CA++  PSLDARQ ++ +EVP+L KEAA KAI+EWGQ KS ITHLIFC+T+  D+PGAD+++ KL+GL PSVKR  ++Q GCFAGGTVLR+AKDLAEN R
Sbjct:   10 RKLQRADGFASILAIGTANPPNAVDQSTYPDFYFRITGNEHNTELKDKFKRICERSAIKQRYMYLTEEILKKNPDVCAFVEVPSLDARQAMLAMEVPRLAKEAAEKAIQEWGQSKSGITHLIFCSTTTPDLPGADFEVAKLLGLHPSVKRVGVFQHGCFAGGTVLRMAKDLAENNR 185          

HSP 2 Score: 56.9954 bits (136), Expect = 6.744e-76
Identity = 25/31 (80.65%), Postives = 30/31 (96.77%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            ++GARVLV+CSE TAVTFRGP++THLDSLVG
Sbjct:  184 NRGARVLVICSETTAVTFRGPSETHLDSLVG 214          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHSY_PERAE (Chalcone synthase OS=Persea americana GN=CHS PE=2 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 5.160e-73
Identity = 120/183 (65.57%), Postives = 137/183 (74.86%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYY-FRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            M  V+ IR  QRA+GPAT++AIGT+TP ++V+Q++YPDYY F    +      +  FKRMC+KSMIKKRYMYLTE   K            L ARQD+VVVEVPKLGKE   KAIK  GQPKSKI  L+FCTTSGVDMPGADYQLTK+ GL PSVKR MMYQQGCFAGGTVLRLAKDLAEN +
Sbjct:    1 MVNVEAIRKVQRAEGPATIMAIGTSTPPNAVDQSEYPDYYYFGSPTASTRPSSRRSFKRMCEKSMIKKRYMYLTETYWKRIQMFVPTWLLPLKARQDMVVVEVPKLGKEVQPKAIKGMGQPKSKINPLVFCTTSGVDMPGADYQLTKVFGLPPSVKRLMMYQQGCFAGGTVLRLAKDLAENNK 183          

HSP 2 Score: 62.003 bits (149), Expect = 5.160e-73
Identity = 29/31 (93.55%), Postives = 31/31 (100.00%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +KGARVLVVCSEITAVTFRGP+DTHLDSLVG
Sbjct:  182 NKGARVLVVCSEITAVTFRGPSDTHLDSLVG 212          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHSA_IPOPL (Chalcone synthase A (Fragment) OS=Ipomoea platensis GN=CHSA PE=2 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 4.321e-72
Identity = 121/175 (69.14%), Postives = 147/175 (84.00%), Query Frame = 2
Query:   74 RNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            R A+R +G A +LA+GTATPA+ V+Q  YPD+YFRIT SEH+ E KEKF+R+C+KS I+KR++ LTEE+LK+NPN+C Y   SL+ RQD +V EVPKLGKEAA KAIKEWG+P S+ITHL+FCTTSGVDMPGAD+QLTKL+GL  SVKR MMYQQGC AG  +LRLAKDLAEN +
Sbjct:   12 RRAKRFEGHAKILAVGTATPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRKRHLVLTEELLKKNPNLCTYNETSLNTRQDTLVSEVPKLGKEAAMKAIKEWGRPISEITHLVFCTTSGVDMPGADFQLTKLLGLNISVKRLMMYQQGCNAGAAMLRLAKDLAENNK 186          

HSP 2 Score: 38.891 bits (89), Expect = 4.321e-72
Identity = 18/30 (60.00%), Postives = 23/30 (76.67%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLV 681
            +KGARVLVVCSE+T   FRGP+    D+L+
Sbjct:  185 NKGARVLVVCSEVTLSVFRGPSLQQEDNLL 214          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHSB_IPOPU (Chalcone synthase B OS=Ipomoea purpurea GN=CHSB PE=3 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 4.712e-71
Identity = 121/175 (69.14%), Postives = 147/175 (84.00%), Query Frame = 2
Query:   74 RNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            R A+R +G A +LAIGTATPA  V+Q  YPD+YFRIT S+H+ E KEKF+R+C+KS I+KR++ LTEE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL+FCTTSGVDMPGAD+QLTKL+GL  SVKR MMYQQGC AG  +LRLAKDLAE+ +
Sbjct:   14 RRAKRLEGDAKILAIGTATPASWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIRKRHLVLTEELLKKNPNLCTYNETSLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAESNK 188          

HSP 2 Score: 35.4242 bits (80), Expect = 4.712e-71
Identity = 17/30 (56.67%), Postives = 22/30 (73.33%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLV 681
            +KG RVLVVC+EIT   FRGP+    D+L+
Sbjct:  187 NKGGRVLVVCAEITINIFRGPSLEQDDNLL 216          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHSA_IPOTF (Chalcone synthase A (Fragment) OS=Ipomoea trifida GN=CHSA PE=3 SV=1)

HSP 1 Score: 251.521 bits (641), Expect = 4.715e-71
Identity = 124/182 (68.13%), Postives = 151/182 (82.97%), Query Frame = 2
Query:   56 ATVQEIRN-AQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            ATVQ   + A+R +G A +LAIGTATP + V+QA YPD+YFRIT SEH+ E KEKF+R+C+KS I+KR++ LT+E+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL+FCTTSGVDMPGAD+QLTKL+GL  SVKR MMYQQGC AG  +LRL KDLAEN +
Sbjct:    5 ATVQLTDDTAKRFEGHAKLLAIGTATPTNWVDQATYPDFYFRITNSEHLLEHKEKFRRICNKSKIRKRHLVLTKELLKKNPNLCTYNDASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLVKDLAENNK 186          

HSP 2 Score: 38.1206 bits (87), Expect = 4.715e-71
Identity = 19/30 (63.33%), Postives = 23/30 (76.67%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLV 681
            +KGARVLVVCSEIT   FRGP+    D+L+
Sbjct:  185 NKGARVLVVCSEITINIFRGPSLEQDDNLL 214          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHSB_IPOCO (Chalcone synthase B (Fragment) OS=Ipomoea cordatotriloba GN=CHSB PE=3 SV=1)

HSP 1 Score: 252.677 bits (644), Expect = 6.149e-71
Identity = 120/175 (68.57%), Postives = 147/175 (84.00%), Query Frame = 2
Query:   74 RNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            R  +R +G A +LAIGTATPA+ V+Q  YPD+YFRIT S+H+ + KEKF+R+C+KS I+KR+M LTEE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL+FCTTSGVDMPGAD+QLTKL+GL  SVKR MMYQQGC AG  +LRLAKD+AEN +
Sbjct:   14 RREKRFEGHAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLDHKEKFRRICNKSKIRKRHMILTEELLKKNPNLCTYNDASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDVAENNK 188          

HSP 2 Score: 36.5798 bits (83), Expect = 6.149e-71
Identity = 17/30 (56.67%), Postives = 22/30 (73.33%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLV 681
            +KGARVLVVCSE+    FRGP+    D+L+
Sbjct:  187 NKGARVLVVCSEVMLSVFRGPSLQQEDNLL 216          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHSA_IPOPU (Chalcone synthase A OS=Ipomoea purpurea GN=CHSA PE=3 SV=2)

HSP 1 Score: 253.062 bits (645), Expect = 1.363e-70
Identity = 120/173 (69.36%), Postives = 146/173 (84.39%), Query Frame = 2
Query:   80 AQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            A+R +G A +LAIGTATPA+ V+Q  YPD+YFRIT SEH+ E KEKF+R+C+KS I KR++ +TEE+LK+NPN+C Y   SL+ RQDI+V EVPKLGK+AA KAIKEWG+P S+ITHL+FCTTSGVDMPGAD+QLTKL+GL  SVKR MMYQQGC AG  +LRLAKDLAEN +
Sbjct:   16 AKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIMKRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKDAAMKAIKEWGRPISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNK 188          

HSP 2 Score: 35.039 bits (79), Expect = 1.363e-70
Identity = 16/30 (53.33%), Postives = 21/30 (70.00%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLV 681
            +KG RVLVVCSE+    FRGP+    D+L+
Sbjct:  187 NKGGRVLVVCSEVMLSVFRGPSLQQEDNLL 216          
The following BLAST results are available for this feature:
BLAST of FC920403 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
CHSB_PETHY1.148e-7872.83Chalcone synthase B OS=Petunia hybrida GN=CHSB PE=... [more]
DPS1_PINST8.053e-7766.11Pinosylvin synthase 1 OS=Pinus strobus GN=STS1 PE=... [more]
DPS2_PINST1.370e-7666.67Pinosylvin synthase 2 OS=Pinus strobus GN=STS2 PE=... [more]
DPSS_PINSY6.744e-7667.05Dihydropinosylvin synthase OS=Pinus sylvestris PE=... [more]
CHSY_PERAE5.160e-7365.57Chalcone synthase OS=Persea americana GN=CHS PE=2 ... [more]
CHSA_IPOPL4.321e-7269.14Chalcone synthase A (Fragment) OS=Ipomoea platensi... [more]
CHSB_IPOPU4.712e-7169.14Chalcone synthase B OS=Ipomoea purpurea GN=CHSB PE... [more]
CHSA_IPOTF4.715e-7168.13Chalcone synthase A (Fragment) OS=Ipomoea trifida ... [more]
CHSB_IPOCO6.149e-7168.57Chalcone synthase B (Fragment) OS=Ipomoea cordatot... [more]
CHSA_IPOPU1.363e-7069.36Chalcone synthase A OS=Ipomoea purpurea GN=CHSA PE... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32007H02EF RVDevelop1 Citrus clementina cDNA clone C32007H02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920403 ID=FC920403|Name=FC920403|organism=Citrus clementina|type=EST|length=689bp
GACACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTG
AAATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCG
GCCACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCA
GGCTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGA
CGGAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAG
AAGCGTTACATGTACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACAT
GTGCGCTTACATGGCTCCATCACTCGACGCACGTCAAGACATTGTGGTGG
TCGAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAA
TGGGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTC
CGGCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCC
TGCGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCC
GGCGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACACAAGGGC
GCTCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCAGTCACTTTCCGCGG
CCCTGCCGATACTCATCTTGATTCTCTTGTGGGCCCAGC
back to top