FC920403

Overview
NameFC920403
Unique NameFC920403
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length689
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:6..695. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHS3_MEDSA (Chalcone synthase 4-1 OS=Medicago sativa GN=CHS4-1 PE=2 SV=1)

HSP 1 Score: 316.62 bits (810), Expect = 1.346e-97
Identity = 150/182 (82.42%), Postives = 168/182 (92.31%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            M +V EIR AQRA+GPAT++AIGTA P++ V Q+ YPD+YF+IT SEH  ELKEKF+RMCDKSMIK+RYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAEN +
Sbjct:    1 MVSVSEIRQAQRAEGPATIMAIGTANPSNCVEQSTYPDFYFKITNSEHKVELKEKFQRMCDKSMIKRRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 61.6178 bits (148), Expect = 1.346e-97
Identity = 28/31 (90.32%), Postives = 31/31 (100.00%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +KGARVLVVCSE+TAVTFRGP+DTHLDSLVG
Sbjct:  181 NKGARVLVVCSEVTAVTFRGPSDTHLDSLVG 211          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHS1_TRISU (Chalcone synthase 1 OS=Trifolium subterraneum GN=CHS1 PE=3 SV=1)

HSP 1 Score: 316.62 bits (810), Expect = 1.346e-97
Identity = 152/182 (83.52%), Postives = 166/182 (91.21%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            M +V EIR AQRA+GPAT+LAIGTA P + V QA YPD+YF+IT SEH  ELKEKF+RMCDKSMIK RYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAEN +
Sbjct:    1 MVSVAEIRKAQRAEGPATILAIGTANPPNRVEQATYPDFYFKITNSEHKVELKEKFQRMCDKSMIKSRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 61.6178 bits (148), Expect = 1.346e-97
Identity = 28/31 (90.32%), Postives = 31/31 (100.00%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +KGARVLVVCSE+TAVTFRGP+DTHLDSLVG
Sbjct:  181 NKGARVLVVCSEVTAVTFRGPSDTHLDSLVG 211          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHSY_DIAMO (Chalcone synthase OS=Dianthus monspessulanus GN=CHS PE=2 SV=1)

HSP 1 Score: 327.02 bits (837), Expect = 1.756e-97
Identity = 154/182 (84.62%), Postives = 171/182 (93.96%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            MA+++EIR AQRADGPAT+LAIGTATP +++ QADYPDYYFR+TKSEHMTELKEKF+RMCDKSMIKKRYMYLTEEILKENPN+C YM  SLD RQD+VV EVP+LGKEAA KAIKEWGQPKSKITH+I CTTSGVDMPGADYQLTKL+GLRPSV+RFM+YQQGCFAGGTVLRLAKDLAEN +
Sbjct:    1 MASIEEIRQAQRADGPATILAIGTATPPNAIYQADYPDYYFRVTKSEHMTELKEKFRRMCDKSMIKKRYMYLTEEILKENPNLCEYMGSSLDTRQDMVVSEVPRLGKEAAVKAIKEWGQPKSKITHVIMCTTSGVDMPGADYQLTKLLGLRPSVRRFMLYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 50.8322 bits (120), Expect = 1.756e-97
Identity = 23/31 (74.19%), Postives = 27/31 (87.10%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +KGARVLVVCSEITA+ FRGP +  LDS+VG
Sbjct:  181 NKGARVLVVCSEITAICFRGPTEAALDSMVG 211          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHS4_PEA (Chalcone synthase 4 OS=Pisum sativum GN=CHS4 PE=3 SV=1)

HSP 1 Score: 316.235 bits (809), Expect = 1.756e-97
Identity = 151/182 (82.97%), Postives = 167/182 (91.76%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            M +V EIR AQRA+GPAT+LAIGTA PA+ V Q+ YPD+YFRIT SEH  ELK+KF+RMCDKSMI +RYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAEN +
Sbjct:    1 MVSVSEIRKAQRAEGPATILAIGTANPANCVEQSTYPDFYFRITNSEHKIELKQKFQRMCDKSMINRRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 61.6178 bits (148), Expect = 1.756e-97
Identity = 28/31 (90.32%), Postives = 31/31 (100.00%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +KGARVLVVCSE+TAVTFRGP+DTHLDSLVG
Sbjct:  181 NKGARVLVVCSEVTAVTFRGPSDTHLDSLVG 211          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHS1_PEA (Chalcone synthase 1 OS=Pisum sativum GN=CHS1 PE=2 SV=1)

HSP 1 Score: 316.235 bits (809), Expect = 1.756e-97
Identity = 151/182 (82.97%), Postives = 167/182 (91.76%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            M +V EIR  QRA+GPAT+LAIGTA PA+ V Q+ YPD+YF+IT SEH T LKEKF+RMCDKSMIK+RYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAEN +
Sbjct:    1 MVSVSEIRKPQRAEGPATILAIGTANPANCVEQSTYPDFYFKITNSEHKTVLKEKFQRMCDKSMIKRRYMYLTEEILKENPSLCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 61.6178 bits (148), Expect = 1.756e-97
Identity = 28/31 (90.32%), Postives = 31/31 (100.00%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +KGARVLVVCSE+TAVTFRGP+DTHLDSLVG
Sbjct:  181 NKGARVLVVCSEVTAVTFRGPSDTHLDSLVG 211          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHS8_BROFI (Chalcone synthase 8 OS=Bromheadia finlaysoniana GN=CHS8 PE=2 SV=1)

HSP 1 Score: 320.857 bits (821), Expect = 2.290e-97
Identity = 152/177 (85.88%), Postives = 168/177 (94.92%), Query Frame = 2
Query:   62 VQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAEN 592
            ++EIR AQRA+GPA VLAIGT+TP +++ QADYPDYYFRITKSEH+TELKEKFKRMCDKSMIKKRYMYLTEEILKENPN+CA+MAPSLDARQDIVV EVPKL KEAA +AIKEWG PKS+ITHLIFCTTSG+DMPGADYQLT+L+GLRPSV RFM+YQQGCFAGGTVLRLAKDLAEN
Sbjct:    5 MEEIRQAQRAEGPAAVLAIGTSTPPNALYQADYPDYYFRITKSEHLTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNICAFMAPSLDARQDIVVTEVPKLAKEAAARAIKEWGHPKSRITHLIFCTTSGIDMPGADYQLTRLLGLRPSVNRFMLYQQGCFAGGTVLRLAKDLAEN 181          

HSP 2 Score: 56.6102 bits (135), Expect = 2.290e-97
Identity = 26/29 (89.66%), Postives = 29/29 (100.00%), Query Frame = 1
Query:  598 GARVLVVCSEITAVTFRGPADTHLDSLVG 684
            GARVLVVCSEITAVTFRGP+++HLDSLVG
Sbjct:  184 GARVLVVCSEITAVTFRGPSESHLDSLVG 212          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHS4_BROFI (Chalcone synthase 4 OS=Bromheadia finlaysoniana GN=CHS4 PE=2 SV=1)

HSP 1 Score: 320.857 bits (821), Expect = 2.290e-97
Identity = 152/177 (85.88%), Postives = 168/177 (94.92%), Query Frame = 2
Query:   62 VQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAEN 592
            ++EIR AQRA+GPA VLAIGT+TP +++ QADYPDYYFRITKSEH+TELKEKFKRMCDKSMIKKRYMYLTEEILKENPN+CA+MAPSLDARQDIVV EVPKL KEAA +AIKEWG PKS+ITHLIFCTTSG+DMPGADYQLT+L+GLRPSV RFM+YQQGCFAGGTVLRLAKDLAEN
Sbjct:    5 MEEIRQAQRAEGPAAVLAIGTSTPPNALYQADYPDYYFRITKSEHLTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNICAFMAPSLDARQDIVVTEVPKLAKEAAVRAIKEWGHPKSRITHLIFCTTSGIDMPGADYQLTRLLGLRPSVNRFMLYQQGCFAGGTVLRLAKDLAEN 181          

HSP 2 Score: 56.6102 bits (135), Expect = 2.290e-97
Identity = 26/29 (89.66%), Postives = 29/29 (100.00%), Query Frame = 1
Query:  598 GARVLVVCSEITAVTFRGPADTHLDSLVG 684
            GARVLVVCSEITAVTFRGP+++HLDSLVG
Sbjct:  184 GARVLVVCSEITAVTFRGPSESHLDSLVG 212          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHS3_BROFI (Chalcone synthase 3 OS=Bromheadia finlaysoniana GN=CHS3 PE=2 SV=1)

HSP 1 Score: 320.857 bits (821), Expect = 2.290e-97
Identity = 152/177 (85.88%), Postives = 168/177 (94.92%), Query Frame = 2
Query:   62 VQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAEN 592
            ++EIR AQRA+GPA VLAIGT+TP +++ QADYPDYYFRITKSEH+TELKEKFKRMCDKSMIKKRYMYLTEEILKENPN+CA+MAPSLDARQDIVV EVPKL KEAA +AIKEWG PKS+ITHLIFCTTSG+DMPGADYQLT+L+GLRPSV RFM+YQQGCFAGGTVLRLAKDLAEN
Sbjct:    5 MEEIRQAQRAEGPAAVLAIGTSTPPNALYQADYPDYYFRITKSEHLTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNICAFMAPSLDARQDIVVTEVPKLAKEAAVRAIKEWGHPKSRITHLIFCTTSGIDMPGADYQLTRLLGLRPSVNRFMLYQQGCFAGGTVLRLAKDLAEN 181          

HSP 2 Score: 56.6102 bits (135), Expect = 2.290e-97
Identity = 26/29 (89.66%), Postives = 29/29 (100.00%), Query Frame = 1
Query:  598 GARVLVVCSEITAVTFRGPADTHLDSLVG 684
            GARVLVVCSEITAVTFRGP+++HLDSLVG
Sbjct:  184 GARVLVVCSEITAVTFRGPSESHLDSLVG 212          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHS3_GERHY (Chalcone synthase 3 OS=Gerbera hybrida GN=CHS3 PE=2 SV=1)

HSP 1 Score: 320.472 bits (820), Expect = 2.987e-97
Identity = 152/179 (84.92%), Postives = 169/179 (94.41%), Query Frame = 2
Query:   62 VQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            V+ IR AQRA+GPAT+LAIGTATPA+ V QADYPDYYFR+T+SEHM +LKEKF+RMCDKSMI+KRYM++TEE LKENP+MC +MAPSLDARQD+VVVEVPKLGKEAATKAIKEWG PKSKITHL+FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAEN +
Sbjct:   10 VETIRKAQRAEGPATILAIGTATPANCVYQADYPDYYFRVTESEHMVDLKEKFQRMCDKSMIRKRYMHITEEFLKENPSMCKFMAPSLDARQDLVVVEVPKLGKEAATKAIKEWGFPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNK 188          

HSP 2 Score: 56.6102 bits (135), Expect = 2.987e-97
Identity = 27/31 (87.10%), Postives = 29/31 (93.55%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +KGARVLVVCSEITAVTFRGP + HLDSLVG
Sbjct:  187 NKGARVLVVCSEITAVTFRGPNEGHLDSLVG 217          
BLAST of FC920403 vs. ExPASy Swiss-Prot
Match: CHS1_SOLLC (Chalcone synthase 1 OS=Solanum lycopersicum GN=CHS1 PE=2 SV=2)

HSP 1 Score: 317.39 bits (812), Expect = 5.086e-97
Identity = 152/182 (83.52%), Postives = 165/182 (90.66%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENTR 598
            M TV+E R AQRA+GPAT+LAIGT+TP++ V+Q+ YPDYYFRIT SEH TELKEKFKRMCDKSMIKKRYM+LTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGK    KAIKEWGQPKSKITHL+FCTTSGVDMP  DYQL KL+ +RPSVKR MMYQQGCFAGGTVLRLAKDLAEN +
Sbjct:    1 MVTVEEYRKAQRAEGPATILAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCDKSMIKKRYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKRGTQKAIKEWGQPKSKITHLVFCTTSGVDMPACDYQLAKLLPVRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 58.9214 bits (141), Expect = 5.086e-97
Identity = 27/31 (87.10%), Postives = 31/31 (100.00%), Query Frame = 1
Query:  592 HKGARVLVVCSEITAVTFRGPADTHLDSLVG 684
            +KGARVLVVCSEITAVTFRGP+++HLDSLVG
Sbjct:  181 NKGARVLVVCSEITAVTFRGPSESHLDSLVG 211          
The following BLAST results are available for this feature:
BLAST of FC920403 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
CHS3_MEDSA1.346e-9782.42Chalcone synthase 4-1 OS=Medicago sativa GN=CHS4-1... [more]
CHS1_TRISU1.346e-9783.52Chalcone synthase 1 OS=Trifolium subterraneum GN=C... [more]
CHSY_DIAMO1.756e-9784.62Chalcone synthase OS=Dianthus monspessulanus GN=CH... [more]
CHS4_PEA1.756e-9782.97Chalcone synthase 4 OS=Pisum sativum GN=CHS4 PE=3 ... [more]
CHS1_PEA1.756e-9782.97Chalcone synthase 1 OS=Pisum sativum GN=CHS1 PE=2 ... [more]
CHS8_BROFI2.290e-9785.88Chalcone synthase 8 OS=Bromheadia finlaysoniana GN... [more]
CHS4_BROFI2.290e-9785.88Chalcone synthase 4 OS=Bromheadia finlaysoniana GN... [more]
CHS3_BROFI2.290e-9785.88Chalcone synthase 3 OS=Bromheadia finlaysoniana GN... [more]
CHS3_GERHY2.987e-9784.92Chalcone synthase 3 OS=Gerbera hybrida GN=CHS3 PE=... [more]
CHS1_SOLLC5.086e-9783.52Chalcone synthase 1 OS=Solanum lycopersicum GN=CHS... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32007H02EF RVDevelop1 Citrus clementina cDNA clone C32007H02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920403 ID=FC920403|Name=FC920403|organism=Citrus clementina|type=EST|length=689bp
GACACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTG
AAATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCG
GCCACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCA
GGCTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGA
CGGAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAG
AAGCGTTACATGTACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACAT
GTGCGCTTACATGGCTCCATCACTCGACGCACGTCAAGACATTGTGGTGG
TCGAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAA
TGGGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTC
CGGCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCC
TGCGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCC
GGCGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACACAAGGGC
GCTCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCAGTCACTTTCCGCGG
CCCTGCCGATACTCATCTTGATTCTCTTGTGGGCCCAGC
back to top