FC920664

Overview
NameFC920664
Unique NameFC920664
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length339
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10212 contig Ccv1_Contig10212:291..629. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP73_YEAST (Heat shock protein SSA3 OS=Saccharomyces cerevisiae GN=SSA3 PE=1 SV=3)

HSP 1 Score: 148.288 bits (373), Expect = 1.143e-35
Identity = 77/111 (69.37%), Postives = 87/111 (78.38%), Query Frame = 2
Query:    5 AMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            A+NP NTVFDAKRLIGR+F D  V  D K +PFKVI+    KP++ V YKGE K F  EEISSMVL KM+E AE YLG T+ +AVVTVPAYFNDSQRQATKDAG IAG+NV
Sbjct:   58 AINPHNTVFDAKRLIGRKFDDPEVTTDAKHFPFKVISRDG-KPVVQVEYKGETKTFTPEEISSMVLSKMKETAENYLGTTVNDAVVTVPAYFNDSQRQATKDAGTIAGMNV 167          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP7C_CAEBR (Heat shock 70 kDa protein C OS=Caenorhabditis briggsae GN=hsp-3 PE=3 SV=2)

HSP 1 Score: 147.902 bits (372), Expect = 1.492e-35
Identity = 71/112 (63.39%), Postives = 91/112 (81.25%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            + +NP NT+FDAKRLIGR ++D +VQ D+K WPFKV+   ++KP + V    + KQF  EE+S+MVL+KM+EIAE+YLG  +K+AVVTVPAYFND+QRQATKDAG IAGLNV
Sbjct:   90 LTINPENTIFDAKRLIGRDYNDKTVQADIKHWPFKVL-DKSNKPSVEVKVGADNKQFTPEEVSAMVLVKMKEIAESYLGKEVKHAVVTVPAYFNDAQRQATKDAGTIAGLNV 200          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP76_YEAST (Heat shock protein SSB2 OS=Saccharomyces cerevisiae GN=SSB2 PE=1 SV=2)

HSP 1 Score: 146.362 bits (368), Expect = 4.342e-35
Identity = 75/111 (67.57%), Postives = 88/111 (79.28%), Query Frame = 2
Query:    5 AMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            A+NP NTVFDAKRLIGRRF D SVQ DMK WPFKVI    + P+I V Y  E K F+ +EIS+MVL KM+EIAEA +G  ++ AV+TVPAYFND+QRQATKDAG I+GLNV
Sbjct:   62 ALNPRNTVFDAKRLIGRRFDDESVQKDMKTWPFKVIDVDGN-PVIEVQYLEETKTFSPQEISAMVLTKMKEIAEAKIGKKVEKAVITVPAYFNDAQRQATKDAGAISGLNV 171          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP75_YEAST (Heat shock protein SSB1 OS=Saccharomyces cerevisiae GN=SSB1 PE=1 SV=3)

HSP 1 Score: 146.362 bits (368), Expect = 4.342e-35
Identity = 75/111 (67.57%), Postives = 88/111 (79.28%), Query Frame = 2
Query:    5 AMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            A+NP NTVFDAKRLIGRRF D SVQ DMK WPFKVI    + P+I V Y  E K F+ +EIS+MVL KM+EIAEA +G  ++ AV+TVPAYFND+QRQATKDAG I+GLNV
Sbjct:   62 ALNPRNTVFDAKRLIGRRFDDESVQKDMKTWPFKVIDVDGN-PVIEVQYLEETKTFSPQEISAMVLTKMKEIAEAKIGKKVEKAVITVPAYFNDAQRQATKDAGAISGLNV 171          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP75_CANAL (Heat shock protein SSB1 OS=Candida albicans GN=SSB1 PE=1 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 4.342e-35
Identity = 75/111 (67.57%), Postives = 87/111 (78.38%), Query Frame = 2
Query:    5 AMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            A+NP NTVFDAKRLIGR F D SVQ D+K WPFKV+     +P+I V Y  E K F+ +EISSMVL KM+EIAEA +G  ++ AVVTVPAYFND+QRQATKDAG IAGLNV
Sbjct:   62 ALNPKNTVFDAKRLIGRAFDDESVQKDIKSWPFKVVESNG-QPLIEVEYLDETKTFSPQEISSMVLTKMKEIAEAKIGKKVEKAVVTVPAYFNDAQRQATKDAGAIAGLNV 171          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP75_ZYGRC (Heat shock protein SSB OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / IFO 1130 / NBRC 1623 / NCYC 568) GN=SSB PE=3 SV=3)

HSP 1 Score: 145.976 bits (367), Expect = 5.671e-35
Identity = 74/111 (66.67%), Postives = 88/111 (79.28%), Query Frame = 2
Query:    5 AMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            A+NP NTVFDAKRLIGRRF D SVQ D K WPFK+I    + P++ V Y GE K F+ +EISSMVL KM+EIAEA +G  ++ AV+TVPAYFND+QRQATKDAG I+GLNV
Sbjct:   62 ALNPENTVFDAKRLIGRRFDDESVQKDRKTWPFKLIDVEGN-PVVEVQYLGETKTFSPQEISSMVLTKMKEIAEAKIGQKVEKAVITVPAYFNDAQRQATKDAGSISGLNV 171          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP75_SCHPO (Heat shock protein sks2 OS=Schizosaccharomyces pombe GN=sks2 PE=1 SV=2)

HSP 1 Score: 144.821 bits (364), Expect = 1.263e-34
Identity = 75/111 (67.57%), Postives = 86/111 (77.48%), Query Frame = 2
Query:    5 AMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            AMNP NTVFDAKRLIGRR+ D   Q D+K WPFKVI      P I VNY GE+KQF A+EIS+MVL KM+EI+EA L   ++ AV+TVPAYF+DSQR ATKDAG IAGLNV
Sbjct:   62 AMNPRNTVFDAKRLIGRRYEDPETQKDIKHWPFKVIDNNGI-PTIEVNYLGEKKQFTAQEISAMVLTKMKEISEAKLNKRVEKAVITVPAYFSDSQRAATKDAGAIAGLNV 171          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: GRP78_NEUCR (78 kDa glucose-regulated protein homolog OS=Neurospora crassa GN=grp78 PE=3 SV=3)

HSP 1 Score: 143.665 bits (361), Expect = 2.815e-34
Identity = 72/111 (64.86%), Postives = 88/111 (79.28%), Query Frame = 2
Query:    5 AMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            A NP  T+FD KRLIGR+FSD  VQ D+K +P+KV++   DKP++ V  KGEEK F  EEIS+M+L KM+E AE YLG  + +AVVTVPAYFND+QRQATKDAG+IAGLNV
Sbjct:   95 AANPHRTIFDIKRLIGRKFSDKDVQNDIKHFPYKVVSKD-DKPVVKVEVKGEEKTFTPEEISAMILGKMKETAEGYLGKKVTHAVVTVPAYFNDNQRQATKDAGMIAGLNV 204          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP7D_CAEEL (Heat shock 70 kDa protein D OS=Caenorhabditis elegans GN=hsp-4 PE=1 SV=2)

HSP 1 Score: 142.51 bits (358), Expect = 6.270e-34
Identity = 69/112 (61.61%), Postives = 90/112 (80.36%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            + +NP NT+FDAKRLIGR +++ +VQ D+K WPFK++   ++KP + V    E KQF  EE+S+MVL KM++IAE+YLG  +KNAVVTVPAYFND+Q+QATKDAG IAGLNV
Sbjct:   87 LTINPENTIFDAKRLIGRFYNEKTVQQDIKHWPFKIV-DKSNKPNVEVKVGSETKQFTPEEVSAMVLTKMKQIAESYLGHEVKNAVVTVPAYFNDAQKQATKDAGSIAGLNV 197          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: BIP_SOLLC (Luminal-binding protein OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 6.270e-34
Identity = 75/112 (66.96%), Postives = 89/112 (79.46%), Query Frame = 2
Query:    5 AMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYK-GEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            A+NP  T+FD KRLIGR+F D  VQ DMKL P+K+++    KP I V  K GE K F+ EEIS+M+L KM+E AEA+LG TIK+AVVTVPAYFND+QRQATKDAGVIAGLNV
Sbjct:   92 AVNPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVSKDG-KPYIQVKIKDGEVKVFSPEEISAMILTKMKETAEAFLGKTIKDAVVTVPAYFNDAQRQATKDAGVIAGLNV 202          
The following BLAST results are available for this feature:
BLAST of FC920664 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
HSP73_YEAST1.143e-3569.37Heat shock protein SSA3 OS=Saccharomyces cerevisia... [more]
HSP7C_CAEBR1.492e-3563.39Heat shock 70 kDa protein C OS=Caenorhabditis brig... [more]
HSP76_YEAST4.342e-3567.57Heat shock protein SSB2 OS=Saccharomyces cerevisia... [more]
HSP75_YEAST4.342e-3567.57Heat shock protein SSB1 OS=Saccharomyces cerevisia... [more]
HSP75_CANAL4.342e-3567.57Heat shock protein SSB1 OS=Candida albicans GN=SSB... [more]
HSP75_ZYGRC5.671e-3566.67Heat shock protein SSB OS=Zygosaccharomyces rouxii... [more]
HSP75_SCHPO1.263e-3467.57Heat shock protein sks2 OS=Schizosaccharomyces pom... [more]
GRP78_NEUCR2.815e-3464.8678 kDa glucose-regulated protein homolog OS=Neuros... [more]
HSP7D_CAEEL6.270e-3461.61Heat shock 70 kDa protein D OS=Caenorhabditis eleg... [more]
BIP_SOLLC6.270e-3466.96Luminal-binding protein OS=Solanum lycopersicum PE... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011D10EF RVDevelop1 Citrus clementina cDNA clone C32011D10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920664 ID=FC920664|Name=FC920664|organism=Citrus clementina|type=EST|length=339bp
GGTCGCCATGAACCCCACGAACACCGTCTTTGATGCAAAGAGGTTGATTG
GTAGGAGATTCAGCGATGCATCAGTCCAAGGCGATATGAAGCTATGGCCA
TTTAAGGTGATTGCTGGACCTGCTGACAAGCCCATGATTGGTGTTAACTA
CAAGGGCGAAGAGAAGCAGTTTGCTGCTGAGGAAATCTCGTCTATGGTGC
TCATCAAGATGCGTGAGATTGCTGAGGCTTACCTTGGCGCAACTATTAAG
AATGCAGTCGTTACTGTCCCTGCTTACTTCAATGACTCACAGAGGCAGGC
CACCAAGGATGCCGGTGTCATTGCTGGGCTTAATGTGAT
back to top