FC920664

Overview
NameFC920664
Unique NameFC920664
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length339
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10212 contig Ccv1_Contig10212:291..629. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: BIP1_ARATH (Luminal-binding protein 1 OS=Arabidopsis thaliana GN=At5g28540 PE=1 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 1.544e-32
Identity = 74/112 (66.07%), Postives = 86/112 (76.79%), Query Frame = 2
Query:    5 AMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYK-GEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            A+NP  TVFD KRLIGR+F D  VQ D KL P++++     KP I V  K GE K F+ EEIS+M+L KM+E AEAYLG  IK+AVVTVPAYFND+QRQATKDAGVIAGLNV
Sbjct:   91 AVNPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQIV-NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQATKDAGVIAGLNV 201          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: BIP5_TOBAC (Luminal-binding protein 5 OS=Nicotiana tabacum GN=BIP5 PE=2 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 2.017e-32
Identity = 73/112 (65.18%), Postives = 86/112 (76.79%), Query Frame = 2
Query:    5 AMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYK-GEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            A+NP  T+FD KRLIGR+F D  VQ D KL P++++     KP I V  K GE K F+ EEIS+M+L KM+E AEAYLG  IK+AVVTVPAYFND+QRQATKDAGVIAGLNV
Sbjct:   92 AVNPERTIFDVKRLIGRKFDDKEVQRDKKLVPYEIV-NKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQATKDAGVIAGLNV 202          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: GRP78_CHICK (78 kDa glucose-regulated protein OS=Gallus gallus GN=HSPA5 PE=2 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 4.494e-32
Identity = 75/110 (68.18%), Postives = 86/110 (78.18%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKG-EEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP NTVFDAKRLIGR ++D SVQ D+K  PFKV+   A KP I V+  G + K FA EEIS+MVL KM+E AEAYLG  + +AVVTVPAYFND+QRQATKDAG IAGLNV
Sbjct:   85 NPENTVFDAKRLIGRTWNDPSVQQDIKYLPFKVVEKKA-KPHIQVDVGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNV 193          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP7C_DROME (Heat shock 70 kDa protein cognate 3 OS=Drosophila melanogaster GN=Hsc70-3 PE=2 SV=2)

HSP 1 Score: 135.961 bits (341), Expect = 5.869e-32
Identity = 73/109 (66.97%), Postives = 85/109 (77.98%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP NTVFDAKRLIGR +SD +VQ D+K +PFKV+   + KP I V+     K FA EEIS+MVL KM+E AEAYLG  + +AVVTVPAYFND+QRQATKDAGVIAGL V
Sbjct:   88 NPENTVFDAKRLIGREWSDTNVQHDIKFFPFKVVEKNS-KPHISVDTSQGAKVFAPEEISAMVLGKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGVIAGLQV 195          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: GRP78_YEAST (78 kDa glucose-regulated protein homolog OS=Saccharomyces cerevisiae GN=KAR2 PE=1 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 5.869e-32
Identity = 70/112 (62.50%), Postives = 85/112 (75.89%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VA NP NT+FD KRLIG +++D SVQ D+K  PF V+     KP + V+ KGE+K F  EEIS M+L KM++IAE YLG  + +AVVTVPAYFND+QRQATKDAG IAGLNV
Sbjct:  105 VAANPQNTIFDIKRLIGLKYNDRSVQKDIKHLPFNVV-NKDGKPAVEVSVKGEKKVFTPEEISGMILGKMKQIAEDYLGTKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNV 215          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: GRP78_SPETR (78 kDa glucose-regulated protein OS=Spermophilus tridecemlineatus GN=HSPA5 PE=2 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 7.665e-32
Identity = 74/110 (67.27%), Postives = 85/110 (77.27%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKG-EEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP NTVFDAKRLIGR ++D SVQ D+K  PFKV+     KP I V+  G + K FA EEIS+MVL KM+E AEAYLG  + +AVVTVPAYFND+QRQATKDAG IAGLNV
Sbjct:   87 NPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKT-KPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNV 195          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: GRP78_RAT (78 kDa glucose-regulated protein OS=Rattus norvegicus GN=Hspa5 PE=1 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 7.665e-32
Identity = 74/110 (67.27%), Postives = 85/110 (77.27%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKG-EEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP NTVFDAKRLIGR ++D SVQ D+K  PFKV+     KP I V+  G + K FA EEIS+MVL KM+E AEAYLG  + +AVVTVPAYFND+QRQATKDAG IAGLNV
Sbjct:   87 NPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKT-KPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNV 195          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: GRP78_PONAB (78 kDa glucose-regulated protein OS=Pongo abelii GN=HSPA5 PE=2 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 7.665e-32
Identity = 74/110 (67.27%), Postives = 85/110 (77.27%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKG-EEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP NTVFDAKRLIGR ++D SVQ D+K  PFKV+     KP I V+  G + K FA EEIS+MVL KM+E AEAYLG  + +AVVTVPAYFND+QRQATKDAG IAGLNV
Sbjct:   87 NPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKT-KPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNV 195          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: GRP78_MOUSE (78 kDa glucose-regulated protein OS=Mus musculus GN=Hspa5 PE=1 SV=3)

HSP 1 Score: 135.576 bits (340), Expect = 7.665e-32
Identity = 74/110 (67.27%), Postives = 85/110 (77.27%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKG-EEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP NTVFDAKRLIGR ++D SVQ D+K  PFKV+     KP I V+  G + K FA EEIS+MVL KM+E AEAYLG  + +AVVTVPAYFND+QRQATKDAG IAGLNV
Sbjct:   88 NPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKT-KPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNV 196          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: GRP78_MESAU (78 kDa glucose-regulated protein OS=Mesocricetus auratus GN=HSPA5 PE=1 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 7.665e-32
Identity = 74/110 (67.27%), Postives = 85/110 (77.27%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKG-EEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP NTVFDAKRLIGR ++D SVQ D+K  PFKV+     KP I V+  G + K FA EEIS+MVL KM+E AEAYLG  + +AVVTVPAYFND+QRQATKDAG IAGLNV
Sbjct:   87 NPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKT-KPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNV 195          
The following BLAST results are available for this feature:
BLAST of FC920664 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
BIP1_ARATH1.544e-3266.07Luminal-binding protein 1 OS=Arabidopsis thaliana ... [more]
BIP5_TOBAC2.017e-3265.18Luminal-binding protein 5 OS=Nicotiana tabacum GN=... [more]
GRP78_CHICK4.494e-3268.1878 kDa glucose-regulated protein OS=Gallus gallus ... [more]
HSP7C_DROME5.869e-3266.97Heat shock 70 kDa protein cognate 3 OS=Drosophila ... [more]
GRP78_YEAST5.869e-3262.5078 kDa glucose-regulated protein homolog OS=Saccha... [more]
GRP78_SPETR7.665e-3267.2778 kDa glucose-regulated protein OS=Spermophilus t... [more]
GRP78_RAT7.665e-3267.2778 kDa glucose-regulated protein OS=Rattus norvegi... [more]
GRP78_PONAB7.665e-3267.2778 kDa glucose-regulated protein OS=Pongo abelii G... [more]
GRP78_MOUSE7.665e-3267.2778 kDa glucose-regulated protein OS=Mus musculus G... [more]
GRP78_MESAU7.665e-3267.2778 kDa glucose-regulated protein OS=Mesocricetus a... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011D10EF RVDevelop1 Citrus clementina cDNA clone C32011D10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920664 ID=FC920664|Name=FC920664|organism=Citrus clementina|type=EST|length=339bp
GGTCGCCATGAACCCCACGAACACCGTCTTTGATGCAAAGAGGTTGATTG
GTAGGAGATTCAGCGATGCATCAGTCCAAGGCGATATGAAGCTATGGCCA
TTTAAGGTGATTGCTGGACCTGCTGACAAGCCCATGATTGGTGTTAACTA
CAAGGGCGAAGAGAAGCAGTTTGCTGCTGAGGAAATCTCGTCTATGGTGC
TCATCAAGATGCGTGAGATTGCTGAGGCTTACCTTGGCGCAACTATTAAG
AATGCAGTCGTTACTGTCCCTGCTTACTTCAATGACTCACAGAGGCAGGC
CACCAAGGATGCCGGTGTCATTGCTGGGCTTAATGTGAT
back to top