FC920664

Overview
NameFC920664
Unique NameFC920664
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length339
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10212 contig Ccv1_Contig10212:291..629. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: GRP78_HUMAN (78 kDa glucose-regulated protein OS=Homo sapiens GN=HSPA5 PE=1 SV=2)

HSP 1 Score: 135.576 bits (340), Expect = 7.665e-32
Identity = 74/110 (67.27%), Postives = 85/110 (77.27%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKG-EEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP NTVFDAKRLIGR ++D SVQ D+K  PFKV+     KP I V+  G + K FA EEIS+MVL KM+E AEAYLG  + +AVVTVPAYFND+QRQATKDAG IAGLNV
Sbjct:   87 NPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKT-KPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNV 195          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: GRP78_BOVIN (78 kDa glucose-regulated protein OS=Bos taurus GN=HSPA5 PE=2 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 7.665e-32
Identity = 74/110 (67.27%), Postives = 85/110 (77.27%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKG-EEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP NTVFDAKRLIGR ++D SVQ D+K  PFKV+     KP I V+  G + K FA EEIS+MVL KM+E AEAYLG  + +AVVTVPAYFND+QRQATKDAG IAGLNV
Sbjct:   88 NPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKT-KPYIQVDVGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNV 196          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: BIP_SPIOL (Luminal-binding protein OS=Spinacia oleracea GN=HSC70 PE=2 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 7.665e-32
Identity = 72/112 (64.29%), Postives = 85/112 (75.89%), Query Frame = 2
Query:    5 AMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYK-GEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            A NP  T+FD KRLIGR+F D  VQ DMKL P+K++     KP I V  + GE K F+ EEIS+M+L KM+E AE +LG  IK+AVVTVPAYFND+QRQATKDAGVIAGLNV
Sbjct:   92 AANPERTIFDVKRLIGRKFEDKEVQKDMKLVPYKIVNRDG-KPYIQVKVQEGETKVFSPEEISAMILTKMKETAETFLGKKIKDAVVTVPAYFNDAQRQATKDAGVIAGLNV 202          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: GRP78_APLCA (78 kDa glucose-regulated protein OS=Aplysia californica PE=1 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 1.001e-31
Identity = 72/109 (66.06%), Postives = 81/109 (74.31%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP NT+FD KRLIGR F D SVQ D+K +PFKV     +KP I       ++ FA EEIS+MVL KMR+IAE YLG  I NAVVTVPAYFND+QRQATKDAG IAGLNV
Sbjct:   97 NPENTIFDVKRLIGRTFDDKSVQHDIKFYPFKV-TNANNKPHIQAATGEGDRSFAPEEISAMVLSKMRDIAEEYLGKKITNAVVTVPAYFNDAQRQATKDAGTIAGLNV 204          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP72_PARLI (Heat shock 70 kDa protein II (Fragment) OS=Paracentrotus lividus GN=HSP70II PE=3 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 2.230e-31
Identity = 71/112 (63.39%), Postives = 87/112 (77.68%), Query Frame = 2
Query:    5 AMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGA-TIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            A NP  ++ DAKRLIGR FSD +V+ DMK WPF VI     +P I + +KGE K F AEEISSMVL+KM+E AEAYLG  ++ +AVVTVPAYFNDSQRQATK+ GVI+G+N+
Sbjct:   60 ASNPYRSL-DAKRLIGRNFSDTNVKADMKHWPFTVIE-EGGRPKIKIEFKGESKTFYAEEISSMVLLKMKETAEAYLGKESVTDAVVTVPAYFNDSQRQATKECGVISGMNI 169          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: GRP78_YARLI (78 kDa glucose-regulated protein homolog OS=Yarrowia lipolytica GN=KAR2 PE=3 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 2.913e-31
Identity = 67/111 (60.36%), Postives = 86/111 (77.48%), Query Frame = 2
Query:    5 AMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            A NP NT+FD KRLIG ++ D SVQ D+K +P+KV      KP++ V  KGE+K +  EEIS+M+L KM++IA+ YLG  + +AVVTVPAYFND+QRQATKDAG+IAGLNV
Sbjct:   93 ANNPFNTIFDIKRLIGLKYKDESVQRDIKHFPYKV-KNKDGKPVVVVETKGEKKTYTPEEISAMILTKMKDIAQDYLGKKVTHAVVTVPAYFNDAQRQATKDAGIIAGLNV 202          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: GRP78_KLULA (78 kDa glucose-regulated protein homolog OS=Kluyveromyces lactis GN=GRP78 PE=3 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 4.968e-31
Identity = 65/111 (58.56%), Postives = 85/111 (76.58%), Query Frame = 2
Query:    5 AMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            A NP NT+FD KRLIG +++D +VQ D+K  P+ V+    +KP + V  KGE+K+F  EE+S M+L KM++IAE YLG  + +AVVTVPAYFND+QRQATKDAG IAGLN+
Sbjct:  107 ASNPKNTIFDIKRLIGLQYNDPTVQRDIKHLPYTVV-NKGNKPYVEVTVKGEKKEFTPEEVSGMILGKMKQIAEDYLGKKVTHAVVTVPAYFNDAQRQATKDAGAIAGLNI 216          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: GRP78_SCHPO (78 kDa glucose-regulated protein homolog OS=Schizosaccharomyces pombe GN=bip1 PE=2 SV=2)

HSP 1 Score: 132.494 bits (332), Expect = 6.489e-31
Identity = 63/109 (57.80%), Postives = 86/109 (78.90%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP NT+FD KRLIGR+F + ++  D+K +PF ++    ++P++ VN  G++K+F  EEIS+M+L KM++ AEAYLG  + +AVVTVPAYFND+QRQATKDAG IAGLNV
Sbjct:   93 NPENTIFDIKRLIGRKFDEKTMAKDIKSFPFHIV-NDKNRPLVEVNVGGKKKKFTPEEISAMILSKMKQTAEAYLGKPVTHAVVTVPAYFNDAQRQATKDAGTIAGLNV 200          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: GRP78_ASHGO (78 kDa glucose-regulated protein homolog OS=Ashbya gossypii GN=KAR2 PE=3 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 2.466e-30
Identity = 69/115 (60.00%), Postives = 85/115 (73.91%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADK---PMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VA NP NT+FD KRLIG +++D +VQ ++K  PF+V+    DK   P + V  KGE K F  EEIS MVL KM++IAE YLG  + +AVVTVPAYFND+QRQATKDAG IAGLN+
Sbjct:  102 VANNPKNTIFDIKRLIGLKYNDKTVQREIKHLPFEVV----DKNGMPAVAVTVKGERKLFTPEEISGMVLGKMKQIAEEYLGKKVTHAVVTVPAYFNDAQRQATKDAGAIAGLNI 212          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: GRP78_PLAFO (78 kDa glucose-regulated protein homolog OS=Plasmodium falciparum (isolate NF54) PE=3 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 5.493e-30
Identity = 65/110 (59.09%), Postives = 83/110 (75.45%), Query Frame = 2
Query:    8 MNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            ++PT TVFD KRLIGR+F D  V  D  L P++++     KP I V  K ++  FA E+IS+MVL KM+EIA+++LG  +KNAVVTVPAYFND+QRQATKDAG IAGLN+
Sbjct:   85 VHPTQTVFDVKRLIGRKFDDQEVVKDRSLLPYEIVNNQG-KPNIKVQIKDKDTTFAPEQISAMVLEKMKEIAQSFLGKPVKNAVVTVPAYFNDAQRQATKDAGTIAGLNI 193          
The following BLAST results are available for this feature:
BLAST of FC920664 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
GRP78_HUMAN7.665e-3267.2778 kDa glucose-regulated protein OS=Homo sapiens G... [more]
GRP78_BOVIN7.665e-3267.2778 kDa glucose-regulated protein OS=Bos taurus GN=... [more]
BIP_SPIOL7.665e-3264.29Luminal-binding protein OS=Spinacia oleracea GN=HS... [more]
GRP78_APLCA1.001e-3166.0678 kDa glucose-regulated protein OS=Aplysia califo... [more]
HSP72_PARLI2.230e-3163.39Heat shock 70 kDa protein II (Fragment) OS=Paracen... [more]
GRP78_YARLI2.913e-3160.3678 kDa glucose-regulated protein homolog OS=Yarrow... [more]
GRP78_KLULA4.968e-3158.5678 kDa glucose-regulated protein homolog OS=Kluyve... [more]
GRP78_SCHPO6.489e-3157.8078 kDa glucose-regulated protein homolog OS=Schizo... [more]
GRP78_ASHGO2.466e-3060.0078 kDa glucose-regulated protein homolog OS=Ashbya... [more]
GRP78_PLAFO5.493e-3059.0978 kDa glucose-regulated protein homolog OS=Plasmo... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011D10EF RVDevelop1 Citrus clementina cDNA clone C32011D10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920664 ID=FC920664|Name=FC920664|organism=Citrus clementina|type=EST|length=339bp
GGTCGCCATGAACCCCACGAACACCGTCTTTGATGCAAAGAGGTTGATTG
GTAGGAGATTCAGCGATGCATCAGTCCAAGGCGATATGAAGCTATGGCCA
TTTAAGGTGATTGCTGGACCTGCTGACAAGCCCATGATTGGTGTTAACTA
CAAGGGCGAAGAGAAGCAGTTTGCTGCTGAGGAAATCTCGTCTATGGTGC
TCATCAAGATGCGTGAGATTGCTGAGGCTTACCTTGGCGCAACTATTAAG
AATGCAGTCGTTACTGTCCCTGCTTACTTCAATGACTCACAGAGGCAGGC
CACCAAGGATGCCGGTGTCATTGCTGGGCTTAATGTGAT
back to top