FC920664

Overview
NameFC920664
Unique NameFC920664
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length339
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10212 contig Ccv1_Contig10212:291..629. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: GRP78_PICAN (78 kDa glucose-regulated protein homolog OS=Pichia angusta GN=BiP PE=3 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 5.493e-30
Identity = 66/112 (58.93%), Postives = 82/112 (73.21%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            +A NPTNT+FD KRLIG RF D  +Q ++K  P+KV      +P++     GE K F AEEIS+M+L KM++IAE YLG  + +AVVTVPAYFND+QRQATKDAG IAGL V
Sbjct:   95 IASNPTNTIFDIKRLIGHRFDDKVIQKEIKHLPYKV-KDQDGRPVVEAKVNGELKTFTAEEISAMILGKMKQIAEDYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLEV 205          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: GRP78_ASPNG (78 kDa glucose-regulated protein homolog OS=Aspergillus niger GN=bipA PE=2 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 3.560e-29
Identity = 66/111 (59.46%), Postives = 79/111 (71.17%), Query Frame = 2
Query:    5 AMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            A NP  T+FD KRLIGR+F D  VQ D K +P+KV+     KP + V+     K    EE+S+MVL KM+EIAE YLG  + +AVVTVPAYFND+QRQATKDAG IAGLNV
Sbjct:  105 AANPRRTIFDIKRLIGRKFDDKDVQKDAKHFPYKVV-NKDGKPHVKVDVNQTPKTLTPEEVSAMVLGKMKEIAEGYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNV 214          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: GRP78_ASPKA (78 kDa glucose-regulated protein homolog OS=Aspergillus kawachi GN=bipA PE=3 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 3.560e-29
Identity = 66/111 (59.46%), Postives = 79/111 (71.17%), Query Frame = 2
Query:    5 AMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            A NP  T+FD KRLIGR+F D  VQ D K +P+KV+     KP + V+     K    EE+S+MVL KM+EIAE YLG  + +AVVTVPAYFND+QRQATKDAG IAGLNV
Sbjct:  105 AANPRRTIFDIKRLIGRKFDDKDVQKDAKHFPYKVV-NKDGKPHVKVDVNQTPKTLTPEEVSAMVLGKMKEIAEGYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNV 214          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: GRP78_ASPAW (78 kDa glucose-regulated protein homolog OS=Aspergillus awamori GN=bipA PE=2 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 3.560e-29
Identity = 66/111 (59.46%), Postives = 79/111 (71.17%), Query Frame = 2
Query:    5 AMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            A NP  T+FD KRLIGR+F D  VQ D K +P+KV+     KP + V+     K    EE+S+MVL KM+EIAE YLG  + +AVVTVPAYFND+QRQATKDAG IAGLNV
Sbjct:  105 AANPRRTIFDIKRLIGRKFDDKDVQKDAKHFPYKVV-NKDGKPHVKVDVNQTPKTLTPEEVSAMVLGKMKEIAEGYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNV 214          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP7M_PEA (Heat shock 70 kDa protein, mitochondrial OS=Pisum sativum GN=HSP1 PE=2 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 6.715e-28
Identity = 62/109 (56.88%), Postives = 78/109 (71.56%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NPTNT+F  KRLIGRRF DA  Q +MK+ P+K++  P     +  N     +Q++  +I + VL K++E AEAYLG TI  AVVTVPAYFND+QRQATKDAG IAGL+V
Sbjct:  111 NPTNTLFGTKRLIGRRFDDAQTQKEMKMVPYKIVRAPNGDAWVEAN----GQQYSPSQIGAFVLTKIKETAEAYLGKTISKAVVTVPAYFNDAQRQATKDAGRIAGLDV 215          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP7M_PHAVU (Heat shock 70 kDa protein, mitochondrial OS=Phaseolus vulgaris PE=2 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 8.770e-28
Identity = 61/109 (55.96%), Postives = 77/109 (70.64%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NPTNTVF  KRLIGRRF D   Q +MK+ PFK++  P     +  N     +Q++  +I + VL KM+E AEAYLG ++  AV+TVPAYFND+QRQATKDAG IAGL+V
Sbjct:  110 NPTNTVFGTKRLIGRRFDDPQTQKEMKMVPFKIVKAPNGDAWVEAN----GQQYSPSQIGAFVLTKMKETAEAYLGKSVSKAVITVPAYFNDAQRQATKDAGRIAGLDV 214          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: GRP78_DEBHA (78 kDa glucose-regulated protein homolog OS=Debaryomyces hansenii GN=KAR2 PE=3 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 8.770e-28
Identity = 63/109 (57.80%), Postives = 79/109 (72.48%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            N  NTVFD KRLIG +++D  VQ ++K  P+K+      KP++ V +  E K F+ EEIS M+L KM+ IAE Y+G  I +AVVTVPAYFND+QRQATKDAG IAGLNV
Sbjct:  107 NVENTVFDIKRLIGLKYNDKMVQKEIKHLPYKIDKKDG-KPVVKVEFNDETKTFSPEEISGMILTKMKSIAEEYMGKKITHAVVTVPAYFNDAQRQATKDAGTIAGLNV 214          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP7C_TRYBB (Heat shock cognate HSP70 protein OS=Trypanosoma brucei brucei PE=3 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 1.145e-27
Identity = 63/111 (56.76%), Postives = 75/111 (67.57%), Query Frame = 2
Query:    5 AMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            A      +FDAKRLIGR+FSD+ VQ DMK WPFKV  G     ++ V + GE      E+IS+ VL  ++  AE+YLG  +  AVVTVPAYFNDSQRQATKDAG IAGL V
Sbjct:   60 ARGSNGVIFDAKRLIGRKFSDSVVQSDMKHWPFKVEEGEKGGAVMRVEHLGEGMLLQPEQISARVLAYLKSCAESYLGKQVAKAVVTVPAYFNDSQRQATKDAGTIAGLEV 170          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: DNAK_AGRT5 (Chaperone protein dnaK OS=Agrobacterium tumefaciens (strain C58 / ATCC 33970) GN=dnaK PE=2 SV=2)

HSP 1 Score: 118.627 bits (296), Expect = 9.696e-27
Identity = 58/109 (53.21%), Postives = 80/109 (73.39%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NPTNT+F  KRLIGRR+ D +V+ D  L PF+++ G      +    K ++K ++  +IS+M+L KM+E AE+YLG  ++ AV+TVPAYFND+QRQATKDAG IAGL+V
Sbjct:   61 NPTNTLFAVKRLIGRRYEDPTVEKDKALVPFEIVKGDNGDAWV----KAQDKNYSPSQISAMILQKMKETAESYLGEKVEKAVITVPAYFNDAQRQATKDAGRIAGLDV 165          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: DNAK_RHIEC (Chaperone protein dnaK OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=dnaK PE=2 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 2.821e-26
Identity = 59/109 (54.13%), Postives = 77/109 (70.64%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NPTNT+F  KRLIGRR+ D +V+ D  L PF ++ G      +  N KG    ++  +IS+M+L KM+E AE+YLG  ++ AV+TVPAYFND+QRQATKDAG IAGL V
Sbjct:   61 NPTNTLFAVKRLIGRRYEDPTVEKDKHLVPFSIVKGDNGDAWVEANGKG----YSPAQISAMILQKMKETAESYLGEKVEKAVITVPAYFNDAQRQATKDAGKIAGLEV 165          
The following BLAST results are available for this feature:
BLAST of FC920664 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
GRP78_PICAN5.493e-3058.9378 kDa glucose-regulated protein homolog OS=Pichia... [more]
GRP78_ASPNG3.560e-2959.4678 kDa glucose-regulated protein homolog OS=Asperg... [more]
GRP78_ASPKA3.560e-2959.4678 kDa glucose-regulated protein homolog OS=Asperg... [more]
GRP78_ASPAW3.560e-2959.4678 kDa glucose-regulated protein homolog OS=Asperg... [more]
HSP7M_PEA6.715e-2856.88Heat shock 70 kDa protein, mitochondrial OS=Pisum ... [more]
HSP7M_PHAVU8.770e-2855.96Heat shock 70 kDa protein, mitochondrial OS=Phaseo... [more]
GRP78_DEBHA8.770e-2857.8078 kDa glucose-regulated protein homolog OS=Debary... [more]
HSP7C_TRYBB1.145e-2756.76Heat shock cognate HSP70 protein OS=Trypanosoma br... [more]
DNAK_AGRT59.696e-2753.21Chaperone protein dnaK OS=Agrobacterium tumefacien... [more]
DNAK_RHIEC2.821e-2654.13Chaperone protein dnaK OS=Rhizobium etli (strain C... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011D10EF RVDevelop1 Citrus clementina cDNA clone C32011D10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920664 ID=FC920664|Name=FC920664|organism=Citrus clementina|type=EST|length=339bp
GGTCGCCATGAACCCCACGAACACCGTCTTTGATGCAAAGAGGTTGATTG
GTAGGAGATTCAGCGATGCATCAGTCCAAGGCGATATGAAGCTATGGCCA
TTTAAGGTGATTGCTGGACCTGCTGACAAGCCCATGATTGGTGTTAACTA
CAAGGGCGAAGAGAAGCAGTTTGCTGCTGAGGAAATCTCGTCTATGGTGC
TCATCAAGATGCGTGAGATTGCTGAGGCTTACCTTGGCGCAACTATTAAG
AATGCAGTCGTTACTGTCCCTGCTTACTTCAATGACTCACAGAGGCAGGC
CACCAAGGATGCCGGTGTCATTGCTGGGCTTAATGTGAT
back to top