FC920664

Overview
NameFC920664
Unique NameFC920664
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length339
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10212 contig Ccv1_Contig10212:291..629. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: DNAK_ACIB5 (Chaperone protein dnaK OS=Acinetobacter baumannii (strain AB0057) GN=dnaK PE=2 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 2.388e-25
Identity = 59/109 (54.13%), Postives = 78/109 (71.56%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP NT+F  KRLIGRR+ D +VQ D+ L P+K+I        + VN    +K+ A ++IS+ +L KM++ AE YLG T+  AV+TVPAYFND+QRQATKDAG IAGL+V
Sbjct:   60 NPKNTLFAIKRLIGRRYEDQAVQKDIGLVPYKIIKADNGDAWVEVN----DKKLAPQQISAEILKKMKKTAEDYLGETVTEAVITVPAYFNDAQRQATKDAGKIAGLDV 164          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: DNAK_ACIB3 (Chaperone protein dnaK OS=Acinetobacter baumannii (strain AB307-0294) GN=dnaK PE=2 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 2.388e-25
Identity = 59/109 (54.13%), Postives = 78/109 (71.56%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP NT+F  KRLIGRR+ D +VQ D+ L P+K+I        + VN    +K+ A ++IS+ +L KM++ AE YLG T+  AV+TVPAYFND+QRQATKDAG IAGL+V
Sbjct:   60 NPKNTLFAIKRLIGRRYEDQAVQKDIGLVPYKIIKADNGDAWVEVN----DKKLAPQQISAEILKKMKKTAEDYLGETVTEAVITVPAYFNDAQRQATKDAGKIAGLDV 164          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: GRP75_RAT (Stress-70 protein, mitochondrial OS=Rattus norvegicus GN=Hspa9 PE=1 SV=3)

HSP 1 Score: 113.62 bits (283), Expect = 3.119e-25
Identity = 59/109 (54.13%), Postives = 73/109 (66.97%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP NT +  KRLIGRR+ D  VQ D K  PFK++        +    +   K ++  +I + VL+KM+E AE YLG T KNAV+TVPAYFNDSQRQATKDAG I+GLNV
Sbjct:  112 NPNNTFYATKRLIGRRYDDPEVQKDTKNVPFKIVRASNGDAWV----EAHGKLYSPSQIGAFVLMKMKETAENYLGHTAKNAVITVPAYFNDSQRQATKDAGQISGLNV 216          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: GRP75_MOUSE (Stress-70 protein, mitochondrial OS=Mus musculus GN=Hspa9 PE=1 SV=2)

HSP 1 Score: 113.62 bits (283), Expect = 3.119e-25
Identity = 59/109 (54.13%), Postives = 73/109 (66.97%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP NT +  KRLIGRR+ D  VQ D K  PFK++        +    +   K ++  +I + VL+KM+E AE YLG T KNAV+TVPAYFNDSQRQATKDAG I+GLNV
Sbjct:  112 NPNNTFYATKRLIGRRYDDPEVQKDTKNVPFKIVRASNGDAWV----EAHGKLYSPSQIGAFVLMKMKETAENYLGHTAKNAVITVPAYFNDSQRQATKDAGQISGLNV 216          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: GRP75_CRIGR (Stress-70 protein, mitochondrial OS=Cricetulus griseus GN=HSPA9 PE=2 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 3.119e-25
Identity = 59/109 (54.13%), Postives = 73/109 (66.97%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP NT +  KRLIGRR+ D  VQ D K  PFK++        +    +   K ++  +I + VL+KM+E AE YLG T KNAV+TVPAYFNDSQRQATKDAG I+GLNV
Sbjct:  112 NPNNTFYATKRLIGRRYDDPEVQKDTKNVPFKIVRASNGDAWV----EAHGKLYSPSQIGAFVLMKMKETAENYLGHTAKNAVITVPAYFNDSQRQATKDAGQISGLNV 216          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: DNAK_RHOS5 (Chaperone protein dnaK OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=dnaK PE=2 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 3.119e-25
Identity = 60/109 (55.05%), Postives = 78/109 (71.56%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP+NTVF  KRLIGRR  DA V+ D KL P+ ++ G      + V  +GE+  ++  +IS+ +L KM+E AEAYLG ++  AV+TVPAYFND+QRQATKDAG IAGL V
Sbjct:   60 NPSNTVFAVKRLIGRRVGDAEVEKDKKLVPYAIVNGGNGDAWVEV--RGEK--YSPSQISAFILQKMKETAEAYLGESVTQAVITVPAYFNDAQRQATKDAGKIAGLEV 164          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: DNAK_CELJU (Chaperone protein dnaK OS=Cellvibrio japonicus (strain Ueda107) GN=dnaK PE=2 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 3.119e-25
Identity = 63/109 (57.80%), Postives = 78/109 (71.56%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP NT+F  KRLIGR+F D  VQ D+ + P+K++A  AD     V  KGE+K  A  +IS+ VL KM++ AE YLG  +  AV+TVPAYFNDSQRQATKDAG IAGL+V
Sbjct:   61 NPHNTLFAVKRLIGRKFKDDVVQKDISMVPYKIVA--ADNGDAWVEVKGEKK--APPQISAEVLKKMKKTAEDYLGEKVTEAVITVPAYFNDSQRQATKDAGKIAGLDV 165          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: DNAK_BARBK (Chaperone protein dnaK OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=dnaK PE=2 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 3.119e-25
Identity = 58/109 (53.21%), Postives = 75/109 (68.81%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP  TVF  KRLIGRRF D  V+ D  L P+K++ G      +  N     K+++  +IS+M+L KM+E AE+YLG  ++ AV+TVPAYFND+QRQATKDAG IAGL V
Sbjct:   61 NPEGTVFAVKRLIGRRFDDPMVEKDKALVPYKIVKGDNGDAWVEEN----SKKYSPSQISAMILQKMKETAESYLGEKVEQAVITVPAYFNDAQRQATKDAGKIAGLEV 165          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: DNAK_SHISS (Chaperone protein dnaK OS=Shigella sonnei (strain Ss046) GN=dnaK PE=2 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 4.074e-25
Identity = 63/109 (57.80%), Postives = 76/109 (69.72%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP NT+F  KRLIGRRF D  VQ D+ + PFK+IA  AD     V  KG++   A  +IS+ VL KM++ AE YLG  +  AV+TVPAYFND+QRQATKDAG IAGL V
Sbjct:   61 NPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKIIA--ADNGDAWVEVKGQK--MAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEV 165          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: DNAK_SHIFL (Chaperone protein dnaK OS=Shigella flexneri GN=dnaK PE=2 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 4.074e-25
Identity = 63/109 (57.80%), Postives = 76/109 (69.72%), Query Frame = 2
Query:   11 NPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            NP NT+F  KRLIGRRF D  VQ D+ + PFK+IA  AD     V  KG++   A  +IS+ VL KM++ AE YLG  +  AV+TVPAYFND+QRQATKDAG IAGL V
Sbjct:   61 NPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKIIA--ADNGDAWVEVKGQK--MAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEV 165          
The following BLAST results are available for this feature:
BLAST of FC920664 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
DNAK_ACIB52.388e-2554.13Chaperone protein dnaK OS=Acinetobacter baumannii ... [more]
DNAK_ACIB32.388e-2554.13Chaperone protein dnaK OS=Acinetobacter baumannii ... [more]
GRP75_RAT3.119e-2554.13Stress-70 protein, mitochondrial OS=Rattus norvegi... [more]
GRP75_MOUSE3.119e-2554.13Stress-70 protein, mitochondrial OS=Mus musculus G... [more]
GRP75_CRIGR3.119e-2554.13Stress-70 protein, mitochondrial OS=Cricetulus gri... [more]
DNAK_RHOS53.119e-2555.05Chaperone protein dnaK OS=Rhodobacter sphaeroides ... [more]
DNAK_CELJU3.119e-2557.80Chaperone protein dnaK OS=Cellvibrio japonicus (st... [more]
DNAK_BARBK3.119e-2553.21Chaperone protein dnaK OS=Bartonella bacilliformis... [more]
DNAK_SHISS4.074e-2557.80Chaperone protein dnaK OS=Shigella sonnei (strain ... [more]
DNAK_SHIFL4.074e-2557.80Chaperone protein dnaK OS=Shigella flexneri GN=dna... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011D10EF RVDevelop1 Citrus clementina cDNA clone C32011D10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920664 ID=FC920664|Name=FC920664|organism=Citrus clementina|type=EST|length=339bp
GGTCGCCATGAACCCCACGAACACCGTCTTTGATGCAAAGAGGTTGATTG
GTAGGAGATTCAGCGATGCATCAGTCCAAGGCGATATGAAGCTATGGCCA
TTTAAGGTGATTGCTGGACCTGCTGACAAGCCCATGATTGGTGTTAACTA
CAAGGGCGAAGAGAAGCAGTTTGCTGCTGAGGAAATCTCGTCTATGGTGC
TCATCAAGATGCGTGAGATTGCTGAGGCTTACCTTGGCGCAACTATTAAG
AATGCAGTCGTTACTGTCCCTGCTTACTTCAATGACTCACAGAGGCAGGC
CACCAAGGATGCCGGTGTCATTGCTGGGCTTAATGTGAT
back to top