FC920664

Overview
NameFC920664
Unique NameFC920664
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length339
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10212 contig Ccv1_Contig10212:291..629. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HS71L_RAT (Heat shock 70 kDa protein 1-like OS=Rattus norvegicus GN=Hspa1l PE=2 SV=2)

HSP 1 Score: 164.466 bits (415), Expect = 1.541e-40
Identity = 84/112 (75.00%), Postives = 95/112 (84.82%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NTVFDAKRLIGR+F+D  VQ DMKLWPF+VI   A KP + V+YKGE+K F  EEISSMVL KM+E AEA+LG ++ NAV+TVPAYFNDSQRQATKDAGVIAGLNV
Sbjct:   61 VAMNPQNTVFDAKRLIGRKFNDPVVQSDMKLWPFQVI-NEAGKPKVLVSYKGEKKAFYPEEISSMVLTKMKETAEAFLGHSVTNAVITVPAYFNDSQRQATKDAGVIAGLNV 171          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HS71L_MOUSE (Heat shock 70 kDa protein 1-like OS=Mus musculus GN=Hspa1l PE=2 SV=4)

HSP 1 Score: 164.466 bits (415), Expect = 1.541e-40
Identity = 84/112 (75.00%), Postives = 94/112 (83.93%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NTVFDAKRLIGR+F+D  VQ DMKLWPF+VI   A KP + V+YKGE+K F  EEISSMVL KM+E AEA+LG  + NAV+TVPAYFNDSQRQATKDAGVIAGLNV
Sbjct:   61 VAMNPQNTVFDAKRLIGRKFNDPVVQSDMKLWPFQVI-NEAGKPKVMVSYKGEKKAFYPEEISSMVLTKMKETAEAFLGHNVTNAVITVPAYFNDSQRQATKDAGVIAGLNV 171          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HS71B_BOVIN (Heat shock 70 kDa protein 1B OS=Bos taurus GN=HSPA1B PE=2 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 1.541e-40
Identity = 84/112 (75.00%), Postives = 92/112 (82.14%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VA+NP NTVFDAKRLIGR+F D  VQ DMK WPF+VI    DKP + V+YKGE K F  EEISSMVL KM+EIAEAYLG  + NAV+TVPAYFNDSQRQATKDAGVIAGLNV
Sbjct:   59 VALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFRVI-NDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNV 169          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HS71B_BOSMU (Heat shock 70 kDa protein 1B OS=Bos mutus grunniens GN=HSPA1B PE=2 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 1.541e-40
Identity = 84/112 (75.00%), Postives = 92/112 (82.14%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VA+NP NTVFDAKRLIGR+F D  VQ DMK WPF+VI    DKP + V+YKGE K F  EEISSMVL KM+EIAEAYLG  + NAV+TVPAYFNDSQRQATKDAGVIAGLNV
Sbjct:   59 VALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFRVI-NDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNV 169          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HS71A_BOVIN (Heat shock 70 kDa protein 1A OS=Bos taurus GN=HSPA1A PE=2 SV=2)

HSP 1 Score: 164.466 bits (415), Expect = 1.541e-40
Identity = 84/112 (75.00%), Postives = 92/112 (82.14%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VA+NP NTVFDAKRLIGR+F D  VQ DMK WPF+VI    DKP + V+YKGE K F  EEISSMVL KM+EIAEAYLG  + NAV+TVPAYFNDSQRQATKDAGVIAGLNV
Sbjct:   59 VALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFRVI-NDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNV 169          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP71_PONAB (Heat shock 70 kDa protein 1 OS=Pongo abelii GN=HSPA1 PE=2 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 2.012e-40
Identity = 84/112 (75.00%), Postives = 92/112 (82.14%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VA+NP NTVFDAKRLIGR+F D  VQ DMK WPF+VI    DKP + V+YKGE K F  EEISSMVL KM+EIAEAYLG  + NAV+TVPAYFNDSQRQATKDAGVIAGLNV
Sbjct:   59 VALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVI-NDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNV 169          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP71_HUMAN (Heat shock 70 kDa protein 1A/1B OS=Homo sapiens GN=HSPA1A PE=1 SV=5)

HSP 1 Score: 164.081 bits (414), Expect = 2.012e-40
Identity = 84/112 (75.00%), Postives = 92/112 (82.14%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VA+NP NTVFDAKRLIGR+F D  VQ DMK WPF+VI    DKP + V+YKGE K F  EEISSMVL KM+EIAEAYLG  + NAV+TVPAYFNDSQRQATKDAGVIAGLNV
Sbjct:   59 VALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVI-NDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNV 169          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP70_TRYCR (Heat shock 70 kDa protein OS=Trypanosoma cruzi GN=HSP70 PE=3 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 2.012e-40
Identity = 83/112 (74.11%), Postives = 91/112 (81.25%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NTVFDAKRLIGR+FSD  VQ DMK WPFKVI    DKP+I V ++GE K F  EE+SSMVL KM+EIAE+YLG  +K AVVTVPAYFNDSQRQATKDAG IAGL V
Sbjct:   59 VAMNPRNTVFDAKRLIGRKFSDPVVQSDMKHWPFKVITKGDDKPVIQVQFRGETKTFNPEEVSSMVLSKMKEIAESYLGKQVKKAVVTVPAYFNDSQRQATKDAGTIAGLEV 170          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP70_BRUMA (Heat shock 70 kDa protein OS=Brugia malayi GN=HSP70 PE=3 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 2.012e-40
Identity = 80/112 (71.43%), Postives = 90/112 (80.36%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NTVFDA RLIGR+F D SVQ DMK WPFKV+     KP + V YKGE K F  EEISSMVL+KM+E AEA+LG  +K+AV+TVPAYFNDSQRQATKD+G IAGLNV
Sbjct:   58 VAMNPHNTVFDANRLIGRKFDDGSVQSDMKHWPFKVVNAGGGKPKVQVEYKGETKTFTPEEISSMVLVKMKETAEAFLGHAVKDAVITVPAYFNDSQRQATKDSGAIAGLNV 169          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP72_RAT (Heat shock-related 70 kDa protein 2 OS=Rattus norvegicus GN=Hspa2 PE=2 SV=2)

HSP 1 Score: 163.696 bits (413), Expect = 2.628e-40
Identity = 81/112 (72.32%), Postives = 93/112 (83.04%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNPTNT+FDAKRLIGR+F DA+VQ DMK WPF+V++    KP + V YKGE K F  EEISSMVL KM+EIAEAYLG  +++AV+TVPAYFNDSQRQATKDAG I GLNV
Sbjct:   60 VAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVS-EGGKPKVQVEYKGEMKTFFPEEISSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNV 170          
The following BLAST results are available for this feature:
BLAST of FC920664 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
HS71L_RAT1.541e-4075.00Heat shock 70 kDa protein 1-like OS=Rattus norvegi... [more]
HS71L_MOUSE1.541e-4075.00Heat shock 70 kDa protein 1-like OS=Mus musculus G... [more]
HS71B_BOVIN1.541e-4075.00Heat shock 70 kDa protein 1B OS=Bos taurus GN=HSPA... [more]
HS71B_BOSMU1.541e-4075.00Heat shock 70 kDa protein 1B OS=Bos mutus grunnien... [more]
HS71A_BOVIN1.541e-4075.00Heat shock 70 kDa protein 1A OS=Bos taurus GN=HSPA... [more]
HSP71_PONAB2.012e-4075.00Heat shock 70 kDa protein 1 OS=Pongo abelii GN=HSP... [more]
HSP71_HUMAN2.012e-4075.00Heat shock 70 kDa protein 1A/1B OS=Homo sapiens GN... [more]
HSP70_TRYCR2.012e-4074.11Heat shock 70 kDa protein OS=Trypanosoma cruzi GN=... [more]
HSP70_BRUMA2.012e-4071.43Heat shock 70 kDa protein OS=Brugia malayi GN=HSP7... [more]
HSP72_RAT2.628e-4072.32Heat shock-related 70 kDa protein 2 OS=Rattus norv... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011D10EF RVDevelop1 Citrus clementina cDNA clone C32011D10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920664 ID=FC920664|Name=FC920664|organism=Citrus clementina|type=EST|length=339bp
GGTCGCCATGAACCCCACGAACACCGTCTTTGATGCAAAGAGGTTGATTG
GTAGGAGATTCAGCGATGCATCAGTCCAAGGCGATATGAAGCTATGGCCA
TTTAAGGTGATTGCTGGACCTGCTGACAAGCCCATGATTGGTGTTAACTA
CAAGGGCGAAGAGAAGCAGTTTGCTGCTGAGGAAATCTCGTCTATGGTGC
TCATCAAGATGCGTGAGATTGCTGAGGCTTACCTTGGCGCAACTATTAAG
AATGCAGTCGTTACTGTCCCTGCTTACTTCAATGACTCACAGAGGCAGGC
CACCAAGGATGCCGGTGTCATTGCTGGGCTTAATGTGAT
back to top