FC920697

Overview
NameFC920697
Unique NameFC920697
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length741
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15382 contig Ccv1_Contig15382:10..750. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANX13_MOUSE (Annexin A13 OS=Mus musculus GN=Anxa13 PE=2 SV=3)

HSP 1 Score: 124.405 bits (311), Expect = 6.378e-28
Identity = 76/213 (35.68%), Postives = 122/213 (57.28%), Query Frame = 2
Query:   86 AAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELI--RILTTRSKAQINATLNHYNDAFGNAXHKDLKAD 718
            A  DA++L+KA +G GT+EA II VL+ R + +R+ I++ Y E YG+DL + L+ ELS +F+++ L     P E  A    +A K + +   +L+EI CTRS++++ A K+AY   + +SLE DV   TSG+ RK+LV L+   R +   V+  LA  +AK + D   +  +  +EL    +L  RS  Q+ AT   Y    G    + ++ +
Sbjct:   17 ADRDAKKLYKACKGMGTDEAAIIEVLSSRTSEERQQIKQKYKEKYGKDLEEVLNSELSGNFKKTALALLDRPNEYAARQLQKAMKGVGTDEAMLIEILCTRSNKEIVAIKEAYQRLFGRSLESDVKEDTSGNLRKILVSLLQASRDEEDTVDKELAGQDAKDLYD-AGEGRWGTDELAFNEVLAKRSYKQLRATFQAYQILIGKDMEETIEEE 228          

HSP 2 Score: 79.337 bits (194), Expect = 2.353e-14
Identity = 49/145 (33.79%), Postives = 79/145 (54.48%), Query Frame = 2
Query:   86 AAEDAEQLHKAFQG-WGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLAN---EATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLV 508
            A +DA+ L+ A +G WGT+E     VLA R+  Q +   + Y    G+D+ + +++E S D +++ L       + + Y A+   +A K + +    L+ I  TR+  DL   K  +  +Y+KSL + V   TSGDFRKLLV L+
Sbjct:  172 AGQDAKDLYDAGEGRWGTDELAFNEVLAKRSYKQLRATFQAYQILIGKDMEETIEEETSGDLKKAYLTIVRCAQDLEGYFADLLYKAMKGMGTDEETLIRIIVTRAEVDLQGIKAKFQEKYQKSLSDMVHSDTSGDFRKLLVALL 316          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA7_MACFA (Annexin A7 OS=Macaca fascicularis GN=ANXA7 PE=2 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 2.963e-25
Identity = 69/213 (32.39%), Postives = 116/213 (54.46%), Query Frame = 2
Query:   41 KSTMATLKVPTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIR-ILTTRSKAQINATLNHYN 676
            + T  T++ P     A  DAE L KA +G+GT+E  I+ V+A+R+  QR+ I+  +  +YG+DL+K L  ELS + E  +L   + P   DA+   +A +   +   VL+EI CTR+++++    + Y + + + LE+D+   TSG F +LLV +    R +   VN  +A+ +A+ +      +    E     IL TRS  Q+ AT+  Y+
Sbjct:  173 QGTQGTIR-PAANFDAMRDAEILRKAMKGFGTDEQAIVDVVANRSNDQRQKIKAAFKTSYGKDLIKDLKSELSGNMEELILALFMPPTYYDAWTLRKAMQGAGTQERVLIEILCTRTNQEIREIVRCYQSEFGRDLEKDIRSDTSGHFERLLVSMCQGNRDENQSVNHQMAQEDAQRLYQAGEGRLGTDESCFNMILATRSFPQLRATMEAYS 384          

HSP 2 Score: 68.1662 bits (165), Expect = 5.424e-11
Identity = 47/145 (32.41%), Postives = 74/145 (51.03%), Query Frame = 2
Query:   86 AAEDAEQLHKAFQG-WGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANE---ATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLV 508
            A EDA++L++A +G  GT+E+    +LA R+  Q +   E Y+     DLL ++ +E S   E  +         R A+ A     A K   + +  L+ I  TRS  DL   KQ +   Y+K+L   +A  TSGD+R+ L+ +V
Sbjct:  342 AQEDAQRLYQAGEGRLGTDESCFNMILATRSFPQLRATMEAYSRMANRDLLSSVSREFSGYVESGLKTILQCALNRPAFFAERLYYAMKGAGTDDSTLVRIVVTRSEIDLVQIKQMFAQMYQKTLGTMIAGDTSGDYRRPLLAIV 486          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANX11_HUMAN (Annexin A11 OS=Homo sapiens GN=ANXA11 PE=1 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 2.963e-25
Identity = 72/206 (34.95%), Postives = 111/206 (53.88%), Query Frame = 2
Query:   95 DAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIR-ILTTRSKAQINATLNHYNDAFGNAXHKDL 709
            DAE L KA +G+GT+E  II  L  R+  QR+ I   +   YG+DL+K L  ELS +FE+++L    TP   D Y   EA K + +    L+EI  +RS+  +    +AY A +KK+LEE +   TSG F++LL+ L    R +  +V+M LA+ +A+ +     ++    E     +L +RS+A + A  N Y    G    K +
Sbjct:  205 DAEVLRKAMKGFGTDEQAIIDCLGSRSNKQRQQILLSFKTAYGKDLIKDLKSELSGNFEKTILALMKTPVLFDIYEIKEAIKGVGTDEACLIEILASRSNEHIRELNRAYKAEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDESTNVDMSLAQRDAQELYAAGENRLGTDESKFNAVLCSRSRAHLVAVFNEYQRMTGRDIEKSI 410          

HSP 2 Score: 67.781 bits (164), Expect = 7.084e-11
Identity = 44/144 (30.56%), Postives = 73/144 (50.69%), Query Frame = 2
Query:   86 AAEDAEQLHKAFQG-WGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLA---NEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPL 505
            A  DA++L+ A +   GT+E+   +VL  R+ A    +   Y    G D+ K++ +E+S D E  +L          A+ A   N+A +   + +  L+ I  +RS  DL   +  Y   Y KSL  D++  TSGD+RK+L+ +
Sbjct:  357 AQRDAQELYAAGENRLGTDESKFNAVLCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEEGMLAVVKCLKNTPAFFAERLNKAMRGAGTKDRTLIRIMVSRSETDLLDIRSEYKRMYGKSLYHDISGDTSGDYRKILLKI 500          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA3_HUMAN (Annexin A3 OS=Homo sapiens GN=ANXA3 PE=1 SV=3)

HSP 1 Score: 115.161 bits (287), Expect = 3.869e-25
Identity = 76/211 (36.02%), Postives = 115/211 (54.50%), Query Frame = 2
Query:   83 SAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEE--LIRILTTRSKAQINATLNHYNDAFGNAXHKDL 709
            S + DAE + KA +G GT+E ++IS+L  R+ AQR+LI + Y   YG++L   L  +LS  FE  ++     PA  DA    ++ K   ++   L+EI  TR+SR +    QAY+  YKKSL +D++  TSGDFRK L+ L    R +   V+  LA+ +A+I+  K  +  +  +E     IL  RS  Q+  T + Y     N   KD+
Sbjct:   19 SPSVDAEAIQKAIRGIGTDEKMLISILTERSNAQRQLIVKEYQAAYGKELKDDLKGDLSGHFEHLMVALVTPPAVFDAKQLKKSMKGAGTNEDALIEILTTRTSRQMKDISQAYYTVYKKSLGDDISSETSGDFRKALLTLADGRRDESLKVDEHLAKQDAQILY-KAGENRWGTDEDKFTEILCLRSFPQLKLTFDEYR----NISQKDI 224          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA7_HUMAN (Annexin A7 OS=Homo sapiens GN=ANXA7 PE=1 SV=3)

HSP 1 Score: 114.39 bits (285), Expect = 6.600e-25
Identity = 68/211 (32.23%), Postives = 115/211 (54.50%), Query Frame = 2
Query:   47 TMATLKVPTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIR-ILTTRSKAQINATLNHYN 676
            T  T++ P     A  DAE L KA +G+GT+E  I+ V+A+R+  QR+ I+  +  +YG+DL+K L  ELS + E  +L   + P   DA+   +A +   +   VL+EI CTR+++++    + Y + + + LE+D+   TSG F +LLV +    R +   +N  +A+ +A+ +      +    E     IL TRS  Q+ AT+  Y+
Sbjct:  175 TQGTIR-PAANFDAIRDAEILRKAMKGFGTDEQAIVDVVANRSNDQRQKIKAAFKTSYGKDLIKDLKSELSGNMEELILALFMPPTYYDAWSLRKAMQGAGTQERVLIEILCTRTNQEIREIVRCYQSEFGRDLEKDIRSDTSGHFERLLVSMCQGNRDENQSINHQMAQEDAQRLYQAGEGRLGTDESCFNMILATRSFPQLRATMEAYS 384          

HSP 2 Score: 70.8626 bits (172), Expect = 8.368e-12
Identity = 48/145 (33.10%), Postives = 75/145 (51.72%), Query Frame = 2
Query:   86 AAEDAEQLHKAFQG-WGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANE---ATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLV 508
            A EDA++L++A +G  GT+E+    +LA R+  Q +   E Y+     DLL ++ +E S   E  +         R A+ A     A K   + +  L+ I  TRS  DL   KQ +   Y+K+L   +A  TSGD+R+LL+ +V
Sbjct:  342 AQEDAQRLYQAGEGRLGTDESCFNMILATRSFPQLRATMEAYSRMANRDLLSSVSREFSGYVESGLKTILQCALNRPAFFAERLYYAMKGAGTDDSTLVRIVVTRSEIDLVQIKQMFAQMYQKTLGTMIAGDTSGDYRRLLLAIV 486          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA7_BOVIN (Annexin A7 OS=Bos taurus GN=ANXA7 PE=1 SV=2)

HSP 1 Score: 113.62 bits (283), Expect = 1.126e-24
Identity = 71/213 (33.33%), Postives = 114/213 (53.52%), Query Frame = 2
Query:   41 KSTMATLKVPTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIR-ILTTRSKAQINATLNHYN 676
            + T  T++ P     A  DAE L KA +G+GT+E  II V+A+R+  QR+ I+  +   YG+DL+K L  ELS + E  +L   +     DA+    A K   +   VL+EI CTR+++++    + Y + + + LE+D+   TSG F +LLV +    R +  +VN  LA+ +A+ +      +    E     IL TRS  Q+ AT+  Y+
Sbjct:  148 QGTHGTIR-PAANFDAMRDAEVLRKAMKGFGTDEQAIIDVVANRSNDQRQKIKAAFKTMYGKDLIKDLKSELSGNMEELILALFMPSTYYDAWSLRNAMKGAGTQERVLIEILCTRTNQEIREIVRCYQSEFGRDLEKDIRSDTSGHFERLLVSMCQGNRDENQNVNHQLAQEDAQRLYQAGEGRLGTDESCFNMILATRSFPQLKATMEAYS 359          

HSP 2 Score: 74.3294 bits (181), Expect = 7.569e-13
Identity = 49/145 (33.79%), Postives = 76/145 (52.41%), Query Frame = 2
Query:   86 AAEDAEQLHKAFQG-WGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANE---ATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLV 508
            A EDA++L++A +G  GT+E+    +LA R+  Q K   E Y+     DLL ++ +E S + E  +         R A+ A     + K   + +  L+ I  TRS  DL   KQ +   Y+K+L   +A  TSGD+RKLL+ +V
Sbjct:  317 AQEDAQRLYQAGEGRLGTDESCFNMILATRSFPQLKATMEAYSRMANRDLLNSVSREFSGNVESGLKTILQCALNRPAFFAERLYYSMKGAGTDDSTLVRIVVTRSEIDLVQIKQMFSQMYQKTLGTMIASDTSGDYRKLLLAIV 461          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA3_MOUSE (Annexin A3 OS=Mus musculus GN=Anxa3 PE=2 SV=3)

HSP 1 Score: 112.464 bits (280), Expect = 2.508e-24
Identity = 74/211 (35.07%), Postives = 113/211 (53.55%), Query Frame = 2
Query:   83 SAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEE-LIRILTTRSKAQINATLNHYNDAFGNAXHKDLK 712
            S + DAE + KA +G GT+E  +I++L  R+ AQR+LI + Y   Y ++L   L  +LS  FE  ++     PA  DA    ++ K   +    L+EI  TRSSR +    QAY+  YKKSL +D++  TSGDFRK L+ L    R +   V+  LA+ +A+I+ +   +K    E+    +L  RS  Q+  T + Y     N   KD++
Sbjct:   19 SPSVDAEAIRKAIRGLGTDEKTLINILTERSNAQRQLIVKQYQAAYEQELKDDLKGDLSGHFEHVMVALVTAPALFDANELKKSMKGTGTDEDALIEILTTRSSRQMKEISQAYYTVYKKSLGDDISSETSGDFRKALLTLADGRRDESLKVDEHLAKKDAQILYNAGENKWGTDEDKFTEVLCLRSFPQLKLTFDEYR----NISQKDIE 225          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA3_RAT (Annexin A3 OS=Rattus norvegicus GN=Anxa3 PE=1 SV=4)

HSP 1 Score: 111.694 bits (278), Expect = 4.278e-24
Identity = 72/208 (34.62%), Postives = 112/208 (53.85%), Query Frame = 2
Query:   95 DAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEE--LIRILTTRSKAQINATLNHYNDAFGNAXHKDLK 712
            DAE + KA +G GT+E  +I++L  R+ AQR+LI + Y E Y + L   L  +LS  FE  ++     PA  DA    ++ + + +    L+EI  TR+SR +    QAY+  YKK+L +D++  TSGDFRK L+ L    R +   V+  LA+ +A+ + D   +K +  +E     IL  RS  Q+  T + Y     N   KD++
Sbjct:   24 DAEAIRKAIKGIGTDEKTLINILTERSNAQRQLIVKQYQEAYEQALKADLKGDLSGHFEHVMVALITAPAVFDAKQLKKSMRGMGTDEDTLIEILTTRTSRQMKEISQAYYTAYKKNLRDDISSETSGDFRKALLTLADGGRDESLKVDEHLAKKDAQTLYD-AGEKKWGTDEDKFTEILCLRSFPQLKLTFDEYR----NISQKDIE 226          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANX11_RABIT (Annexin A11 OS=Oryctolagus cuniculus GN=ANXA11 PE=1 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 4.278e-24
Identity = 70/206 (33.98%), Postives = 108/206 (52.43%), Query Frame = 2
Query:   95 DAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIR-ILTTRSKAQINATLNHYNDAFGNAXHKDL 709
            DAE L KA +G+GT+E  II  L  R+  QR+ I   +   YG+DL+K L  ELS +FE+++L    TP   DAY   EA K   +    L+EI  +RS+  +    +AY   +KK+LEE +   TSG F++LL+ L    R +  +V+M L + + + +     ++    E     +L +RS+A + A  N Y    G    K +
Sbjct:  203 DAEVLRKAMKGFGTDEQAIIDCLGSRSNKQRQQILLSFKTAYGKDLIKDLKSELSGNFEKTILALMKTPILFDAYEIKEAIKGAGTDEACLIEILASRSNEHIRELNKAYKTEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDESTNVDMSLVQRDVQELYAAGENRLGTDESKFNAVLCSRSRAHLVAVFNEYQRMTGRDIEKSI 408          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANX11_BOVIN (Annexin A11 OS=Bos taurus GN=ANXA11 PE=1 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 7.297e-24
Identity = 70/206 (33.98%), Postives = 107/206 (51.94%), Query Frame = 2
Query:   95 DAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIR-ILTTRSKAQINATLNHYNDAFGNAXHKDL 709
            DAE L KA +G+GT+E  II  L  R+  QR+ I   +   YG+DL+K L  ELS +FE+++L    TP   DAY   EA K   +    L+EI  +RS+  +    + Y   +KK+LEE +   TSG F++LL+ L    R +  +V+M L + + + +     ++    E     IL +RS+A + A  N Y    G    K +
Sbjct:  203 DAEVLRKAMKGFGTDEQAIIDCLGSRSNKQRQQILLSFKTAYGKDLIKDLKSELSGNFEKTILALMKTPVLFDAYEIKEAIKGAGTDEACLIEILASRSNEHIRELNRVYKTEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDESTNVDMTLVQRDVQELYAAGENRLGTDESKFNAILCSRSRAHLVAVFNEYQRMTGRDIEKSI 408          
The following BLAST results are available for this feature:
BLAST of FC920697 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 85
Match NameE-valueIdentityDescription
ANX13_MOUSE6.378e-2835.68Annexin A13 OS=Mus musculus GN=Anxa13 PE=2 SV=3[more]
ANXA7_MACFA2.963e-2532.39Annexin A7 OS=Macaca fascicularis GN=ANXA7 PE=2 SV... [more]
ANX11_HUMAN2.963e-2534.95Annexin A11 OS=Homo sapiens GN=ANXA11 PE=1 SV=1[more]
ANXA3_HUMAN3.869e-2536.02Annexin A3 OS=Homo sapiens GN=ANXA3 PE=1 SV=3[more]
ANXA7_HUMAN6.600e-2532.23Annexin A7 OS=Homo sapiens GN=ANXA7 PE=1 SV=3[more]
ANXA7_BOVIN1.126e-2433.33Annexin A7 OS=Bos taurus GN=ANXA7 PE=1 SV=2[more]
ANXA3_MOUSE2.508e-2435.07Annexin A3 OS=Mus musculus GN=Anxa3 PE=2 SV=3[more]
ANXA3_RAT4.278e-2434.62Annexin A3 OS=Rattus norvegicus GN=Anxa3 PE=1 SV=4[more]
ANX11_RABIT4.278e-2433.98Annexin A11 OS=Oryctolagus cuniculus GN=ANXA11 PE=... [more]
ANX11_BOVIN7.297e-2433.98Annexin A11 OS=Bos taurus GN=ANXA11 PE=1 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011H05EF RVDevelop1 Citrus clementina cDNA clone C32011H05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920697 ID=FC920697|Name=FC920697|organism=Citrus clementina|type=EST|length=741bp
GACTGCCTCGTCATTTTCTATTTTACAAAAACGCTGAAACAAATCGACAA
TGGCGACCCTTAAAGTGCCAACCCAGACCCCTTCTGCTGCTGAGGATGCT
GAGCAACTCCACAAAGCCTTCCAAGGATGGGGCACGAATGAGGCCCTCAT
TATATCTGTCTTGGCTCACAGAAATGCAGCTCAGCGCAAGTTGATTCGAG
AAATCTACAACGAAACTTATGGGGAAGACCTTCTTAAAGCACTGGACAAA
GAACTTTCAAGTGACTTTGAGAGATCTGTACTGCTATGGACATTGACTCC
TGCTGAGCGTGATGCTTATTTGGCAAATGAAGCGACAAAGAGATTGACTT
CAAGCAACTGGGTTCTCATGGAAATTGCCTGTACTAGATCTTCAAGAGAC
CTATTTGCTGCAAAGCAGGCCTACCATGCTCGTTACAAGAAATCCCTAGA
GGAAGATGTTGCATATCACACATCTGGGGACTTCCGCAAGCTTTTGGTTC
CTCTTGTGAGCACATTTCGATATGATGGAGGAGATGTGAACATGATGTTG
GCAAGAACTGAGGCTAAGATTATCCGTGACAAGATTTCAGACAAGGATTA
TGCTCATGAGGAGCTTATCAGGATTCTGACTACAAGGAGCAAGGCACAGA
TAAATGCGACCCTCAATCACTACAATGATGCTTTTGGAAATGCCATNCAC
AAGGATTTGAAGGCTGATCCCATGATGAATACCTCAACTGC
back to top