FC920697

Overview
NameFC920697
Unique NameFC920697
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length741
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15382 contig Ccv1_Contig15382:10..750. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA6_HUMAN (Annexin A6 OS=Homo sapiens GN=ANXA6 PE=1 SV=3)

HSP 1 Score: 110.153 bits (274), Expect = 1.245e-23
Identity = 65/200 (32.50%), Postives = 106/200 (53.00%), Query Frame = 2
Query:   95 DAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKI-------SDKDYAHEELIRILTTRSKAQINATLNHY 673
            DA+ L KA +G GT+E  II ++ HR+  QR+ IR+ +   +G DL+  L  E+S D  R +L   + PA  DA    +A +   +    L+EI  TR++ ++ A  +AY   Y KSLE+ ++  TSG FR++L+ L +  R +GG+ N+  AR +A++  + +        DK       + IL TRS   +      +
Sbjct:  368 DAKALRKAMKGLGTDEDTIIDIITHRSNVQRQQIRQTFKSHFGRDLMTDLKSEISGDLARLILGLMMPPAHYDAKQLKKAMEGAGTDEKALIEILATRTNAEIRAINEAYKEDYHKSLEDALSSDTSGHFRRILISLATGHREEGGE-NLDQAREDAQVAAEILEIADTPSGDKTSLETRFMTILCTRSYPHLRRVFQEF 566          

HSP 2 Score: 89.7373 bits (221), Expect = 1.741e-17
Identity = 58/210 (27.62%), Postives = 104/210 (49.52%), Query Frame = 2
Query:   92 EDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHE-ELIRILTTRSKAQINATLNHYNDAFGNAXHKDLKAD 718
            +DAE L+ A +G+G+++  I+ ++  R+  QR+ + + Y   YG+DL+  L  EL+  FER ++     PA  DA    +A   + +    L+EI  +R++  +     AY   Y++ LE D+   TSG F+K+LV L+   R +   V+  L + + + + +    K    E + I IL  RSK  +    + Y    G      ++ +
Sbjct:   24 QDAEALYTAMKGFGSDKEAILDIITSRSNRQRQEVCQSYKSLYGKDLIADLKYELTGKFERLIVGLMRPPAYCDAKEIKDAISGIGTDEKCLIEILASRTNEQMHQLVAAYKDAYERDLEADIIGDTSGHFQKMLVVLLQGTREEDDVVSEDLVQQDVQDLYEAGELKWGTDEAQFIYILGNRSKQHLRLVFDEYLKTTGKPIEASIRGE 233          

HSP 3 Score: 70.4774 bits (171), Expect = 1.093e-11
Identity = 61/242 (25.21%), Postives = 106/242 (43.80%), Query Frame = 2
Query:   92 EDAEQLHKAFQ-GWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLAN---EATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPL-------VSTFRYDGGDVNMML------ARTE----------------AKIIRDKISDKDYAHEELIRILTTRSKAQINATLNHYNDAFGNAXHKDLKAD 718
            +D + L++A +  WGT+EA  I +L +R+    +L+ + Y +T G+ +  ++  ELS DFE+ +L           Y A    +A K L + +  L+ I  +RS  D+   ++ +  +Y+KSL   +   TSG+++K L+ L          F  +   V   +      AR E                AK +R  +       + +I I+T RS  Q       +   FG     DLK++
Sbjct:  179 QDVQDLYEAGELKWGTDEAQFIYILGNRSKQHLRLVFDEYLKTTGKPIEASIRGELSGDFEKLMLAVVKCIRSTPEYFAERLFKAMKGLGTRDNTLIRIMVSRSELDMLDIREIFRTKYEKSLYSMIKNDTSGEYKKTLLKLSGGDDDAAGQFFPEAAQVAYQMWELSAVARVELKGTVRPANDFNPDADAKALRKAMKGLGTDEDTIIDIITHRSNVQRQQIRQTFKSHFGRDLMTDLKSE 420          

HSP 4 Score: 69.3218 bits (168), Expect = 2.435e-11
Identity = 63/240 (26.25%), Postives = 102/240 (42.50%), Query Frame = 2
Query:   50 MATLKVPTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLW----------TLTPAERDAYLANEATK-------RLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIRILTTRSKAQINATLNHYNDAFGNAXHKDLKAD 718
            +A L +    P A  DA+QL KA +G GT+E  +I +LA R  A+ + I E Y E Y + L  AL  + S  F R ++             L  A  DA +A E  +         TS     M I CTRS   L    Q +       +E  +    SGD R   V +V + +    +  +  A    K ++   +D+    + L RI+ +RS+  +      + + +  + H+ ++ D
Sbjct:  425 LARLILGLMMPPAHYDAKQLKKAMEGAGTDEKALIEILATRTNAEIRAINEAYKEDYHKSLEDALSSDTSGHFRRILISLATGHREEGGENLDQAREDAQVAAEILEIADTPSGDKTSLETRFMTILCTRSYPHLRRVFQEFIKMTNYDVEHTIKKEMSGDVRDAFVAIVQSVK----NKPLFFADKLYKSMKGAGTDE----KTLTRIMVSRSEIDLLNIRREFIEKYDKSLHQAIEGD 656          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA6_BOVIN (Annexin A6 OS=Bos taurus GN=ANXA6 PE=1 SV=2)

HSP 1 Score: 109.768 bits (273), Expect = 1.626e-23
Identity = 69/200 (34.50%), Postives = 108/200 (54.00%), Query Frame = 2
Query:   95 DAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKI------IRDKIS-DKDYAHEELIRILTTRSKAQINATLNHY 673
            DA+ L KA +G GT+E  II ++AHR+ AQR+ IR+ +   +G DL+  L  ELS D  R +L   + PA  DA    +A +   +    L+EI  TR++ ++ A  +AY   Y KSLE+ ++  TSG F+++L+ L +  R +GG+ +   AR +A++      I D  S DK       + IL TRS   +      +
Sbjct:  368 DAKALRKAMKGLGTDEDTIIDIIAHRSNAQRQQIRQTFKSHFGRDLMADLKSELSGDLARLILGLMMPPAHYDAKQLKKAMEGAGTDEKALIEILATRTNAEIQAINKAYKEDYHKSLEDALSSDTSGHFKRILISLATGNREEGGE-DRERAREDAQVAAEILEIADTTSGDKSSLETRFMMILCTRSYPHLRRVFQEF 566          

HSP 2 Score: 92.4337 bits (228), Expect = 2.686e-18
Identity = 60/211 (28.44%), Postives = 105/211 (49.76%), Query Frame = 2
Query:   89 AEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHE-ELIRILTTRSKAQINATLNHYNDAFGNAXHKDLKAD 718
            ++DAE L+ A +G+G+++  I+ ++  R+  QR+ I + Y   YG+DL+  L  EL+  FER ++     PA  DA    +A   + +    L+EI  +R++  +     AY   Y++ LE D+   TSG FRK+LV L+   R +   V+  L + + + + +    K    E + I IL  RSK  +    + Y    G      ++ +
Sbjct:   23 SQDAETLYNAMKGFGSDKEAILELITSRSNRQRQEICQNYKSLYGKDLIADLKYELTGKFERLIVGLMRPPAYADAKEIKDAISGIGTDEKCLIEILASRTNEQIHQLVAAYKDAYERDLEADITGDTSGHFRKMLVVLLQGTREEDDVVSEDLVQQDVQDLYEAGELKWGTDEAQFIYILGNRSKQHLRLVFDEYLKTTGKPIEASIRGE 233          

HSP 3 Score: 69.707 bits (169), Expect = 1.864e-11
Identity = 62/242 (25.62%), Postives = 109/242 (45.04%), Query Frame = 2
Query:   92 EDAEQLHKAFQ-GWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFER---SVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPL-------VSTFRYDGGDVNMML------ARTE----------------AKIIRDKISDKDYAHEELIRILTTRSKAQINATLNHYNDAFGNAXHKDLKAD 718
            +D + L++A +  WGT+EA  I +L +R+    +L+ + Y +T G+ +  ++  ELS DFE+   +V+    + AE  A    +A K L + +  L+ I  +RS  D+   ++ +  +Y+KSL   +   TSG+++K L+ L          F  +   V   +      AR E                AK +R  +       + +I I+  RS AQ       +   FG     DLK++
Sbjct:  179 QDVQDLYEAGELKWGTDEAQFIYILGNRSKQHLRLVFDEYLKTTGKPIEASIRGELSGDFEKLMLAVVKCIRSTAEYFAERLFKAMKGLGTRDNTLIRIMVSRSELDMLDIREIFRTKYEKSLYSMIKNDTSGEYKKTLLKLCGGDDDAAGQFFPEAAQVAYQMWELSAVARVELKGTVRPAGDFNPDADAKALRKAMKGLGTDEDTIIDIIAHRSNAQRQQIRQTFKSHFGRDLMADLKSE 420          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA6_MOUSE (Annexin A6 OS=Mus musculus GN=Anxa6 PE=1 SV=2)

HSP 1 Score: 109.383 bits (272), Expect = 2.123e-23
Identity = 65/200 (32.50%), Postives = 107/200 (53.50%), Query Frame = 2
Query:   95 DAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKI-------SDKDYAHEELIRILTTRSKAQINATLNHY 673
            DA+ L KA +G GT+EA II ++ HR+ AQR+ IR+ +   +G DL+  L  E+S D  R +L   + PA  DA    +A +   +    L+EI  TR++ ++ A  +AY   Y KSLE+ ++  TSG FR++L+ L +  R +GG+ N   A+ +A++  + +        DK       + +L TRS   +      +
Sbjct:  368 DAKALRKAMKGIGTDEATIIDIVTHRSNAQRQQIRQTFKSHFGRDLMADLKSEISGDLARLILGLMMPPAHYDAKQLKKAMEGAGTDEKTLIEILATRTNAEIRAINEAYKEDYHKSLEDALSSDTSGHFRRILISLATGNREEGGE-NRDQAQEDAQVAAEILEIADTPSGDKTSLETRFMTVLCTRSYPHLRRVFQEF 566          

HSP 2 Score: 87.0409 bits (214), Expect = 1.128e-16
Identity = 59/212 (27.83%), Postives = 105/212 (49.53%), Query Frame = 2
Query:   86 AAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHE-ELIRILTTRSKAQINATLNHYNDAFGNAXHKDLKAD 718
            A +DAE L+ A +G+G+++  I+ ++  R+  QR+ I + Y   YG+DL++ L  EL+  FER ++      A  DA    +A   + +    L+EI  +R++  +     AY   Y++ LE D+   TSG F+K+LV L+   R +   V+  L + + + + +    K    E + I IL  RSK  +    + Y    G      ++ +
Sbjct:   22 ANQDAEALYTAMKGFGSDKESILELITSRSNKQRQEICQSYKSLYGKDLIEDLKYELTGKFERLIVNLMRPLAYCDAKEIKDAISGIGTDEKCLIEILASRTNEQMHQLVAAYKDAYERDLESDIIGDTSGHFQKMLVVLLQGTRENDDVVSEDLVQQDVQDLYEAGELKWGTDEAQFIYILGNRSKQHLRLVFDEYLKTTGKPIEASIRGE 233          

HSP 3 Score: 69.3218 bits (168), Expect = 2.435e-11
Identity = 61/242 (25.21%), Postives = 104/242 (42.98%), Query Frame = 2
Query:   92 EDAEQLHKAFQ-GWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLAN---EATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPL---------------------------VSTFRYDGG--DVNMMLARTEAKIIRDKISDKDYAHEELIRILTTRSKAQINATLNHYNDAFGNAXHKDLKAD 718
            +D + L++A +  WGT+EA  I +L +R+    +L+ + Y +T G+ +  ++  ELS DFE+ +L           Y A    +A K L + +  L+ I  +RS  D+   ++ +  +Y+KSL   +   TSG+++K L+ L                           VS     G     N      +AK +R  +         +I I+T RS AQ       +   FG     DLK++
Sbjct:  179 QDVQDLYEAGELKWGTDEAQFIYILGNRSKQHLRLVFDEYLKTTGKPIEASIRGELSGDFEKLMLAVVKCIRSTPEYFAERLFKAMKGLGTRDNTLIRIMVSRSELDMLDIREIFRTKYEKSLYSMIKNDTSGEYKKALLKLCGGDDDAAAQFFPEAAQVAYQMWELSAVSRVELKGTVCAANDFNPDADAKALRKAMKGIGTDEATIIDIVTHRSNAQRQQIRQTFKSHFGRDLMADLKSE 420          

HSP 4 Score: 67.3958 bits (163), Expect = 9.252e-11
Identity = 61/241 (25.31%), Postives = 105/241 (43.57%), Query Frame = 2
Query:   50 MATLKVPTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLT-----------PAERDAYLANEATK-------RLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIRILTTRSKAQINATLNHYNDAFGNAXHKDLKAD 718
            +A L +    P A  DA+QL KA +G GT+E  +I +LA R  A+ + I E Y E Y + L  AL  + S  F R +L+   T            A+ DA +A E  +         TS     M + CTRS   L    Q +  +    +E  +    SGD +   V +V + +    +  +  A    K ++   +D+    + L R++ +RS+  +      + + +  + H+ ++ D
Sbjct:  425 LARLILGLMMPPAHYDAKQLKKAMEGAGTDEKTLIEILATRTNAEIRAINEAYKEDYHKSLEDALSSDTSGHFRR-ILISLATGNREEGGENRDQAQEDAQVAAEILEIADTPSGDKTSLETRFMTVLCTRSYPHLRRVFQEFIKKTNYDIEHVIKKEMSGDVKDAFVAIVQSVK----NKPLFFADKLYKSMKGAGTDE----KTLTRVMVSRSEIDLLNIRREFIEKYDKSLHQAIEGD 656          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA6_CHICK (Annexin A6 OS=Gallus gallus GN=ANXA6 PE=2 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 2.123e-23
Identity = 72/201 (35.82%), Postives = 105/201 (52.24%), Query Frame = 2
Query:   95 DAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRD--KISD------KDYAHEELIRILTTRSKAQINATLNHY 673
            DA+ L KA +G GT+E  II VL  R+ AQR+ I + Y   YG DLL  L  ELS      +L   LTPA+ DA    +A +   +    L+EI  TR+++++ A  +AY   Y KSLE+D++  TS  F++LLV L    R D G  N+  A  +AK++ +  K++D       D      + IL TRS   +      +
Sbjct:  366 DAQVLRKAMKGLGTDEGAIIEVLTQRSNAQRQQILKAYKAHYGRDLLADLKSELSGSLANLILGLMLTPAQYDAKQLRKAVEGDGTDESTLVEIMATRNNQEIAAINEAYQQAYHKSLEDDLSSDTSVHFKRLLVSLALGNR-DEGPENLTQAHEDAKVVAETLKLADVPSNDSSDSLETRFLSILCTRSYPHLRRVFQEF 565          

HSP 2 Score: 95.5153 bits (236), Expect = 3.173e-19
Identity = 63/213 (29.58%), Postives = 109/213 (51.17%), Query Frame = 2
Query:   83 SAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHE-ELIRILTTRSKAQINATLNHYNDAFGNAXHKDLKAD 718
            +A++DA+ L  A +G+G+++  I+ ++  R+  QR  I + Y   YG+DL+  L  EL+  FER ++     PA  DA    +A   + +    L+EI  +R+++++     AY   Y++ LE DV   TSG F+K+LV L+   R +   V+  L   +AK + +    K    E + I IL  RSK  +    + Y    G    + ++A+
Sbjct:   19 NASQDADALCNAMKGFGSDKDAILDLITSRSNKQRLEICQAYKSQYGKDLIADLKYELTGKFERLIVSLMRPPAYSDAKEIKDAIAGIGTDEKCLIEILASRTNQEIHDLVAAYKDAYERDLEADVVGDTSGHFKKMLVVLLQGAREEDDVVSEDLVEQDAKDLLEAGELKWGTDEAQFIYILGRRSKQHLRMVFDEYLKISGKPIERSIRAE 231          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA7_MOUSE (Annexin A7 OS=Mus musculus GN=Anxa7 PE=2 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 2.773e-23
Identity = 67/213 (31.46%), Postives = 113/213 (53.05%), Query Frame = 2
Query:   41 KSTMATLKVPTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIR-ILTTRSKAQINATLNHYN 676
            + T  T+ +P     A  DAE L KA +G+GT+E  I+ V+++R+  QR+ I+  +   YG+DL+K L  ELS + E  +L   +     DA+   +A +   +   VL+EI CTR+++++    + Y   + + LE+D+   TSG F +LLV +    R +   VN  +A+ +A+ +      +    E     IL TRS  Q+ AT+  Y+
Sbjct:  148 QGTQGTI-LPASNFDAMRDAEILRKAMKGFGTDEQAIVDVVSNRSNDQRQQIKAAFKTMYGKDLIKDLKSELSGNMEELILALFMPSTYYDAWSLRKAMQGAGTQERVLIEILCTRTNQEIRDIVRCYQLEFGRDLEKDIRSDTSGHFERLLVSMCQANRDERQSVNHQMAQEDAQRLYQAGEGRLGTDESCFNMILATRSFPQLKATMEAYS 359          

HSP 2 Score: 73.1738 bits (178), Expect = 1.686e-12
Identity = 49/145 (33.79%), Postives = 75/145 (51.72%), Query Frame = 2
Query:   86 AAEDAEQLHKAFQG-WGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANE---ATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLV 508
            A EDA++L++A +G  GT+E+    +LA R+  Q K   E Y+     DLL ++ +E S   E  +         R A+ A     + K   + +  L+ I  TRS  DL   KQ +   Y+K+L   +A  TSGD+RKLL+ +V
Sbjct:  317 AQEDAQRLYQAGEGRLGTDESCFNMILATRSFPQLKATMEAYSRMANRDLLSSVSREFSGYVESGLKTILQCALNRPAFFAERLYYSMKGAGTDDSTLVRIVVTRSEIDLVQIKQMFTQMYQKTLSTMIASDTSGDYRKLLLAIV 461          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANX11_MOUSE (Annexin A11 OS=Mus musculus GN=Anxa11 PE=1 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 2.773e-23
Identity = 69/206 (33.50%), Postives = 107/206 (51.94%), Query Frame = 2
Query:   95 DAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIR-ILTTRSKAQINATLNHYNDAFGNAXHKDL 709
            DAE L KA +G+GT+E  II  L  R+  QR+ I   +   YG+DL+K L  ELS +FE+++L    TP   D Y   EA K   +    L+EI  +RS+  +    +AY   ++K+LEE +   TSG F++LL+ L    R +  +V+M L + + + +     ++    E     IL +RS+A + A  N Y    G    K +
Sbjct:  203 DAEVLRKAMKGFGTDEQAIIDCLGSRSNKQRQQILLSFKTAYGKDLIKDLKSELSGNFEKTILALMKTPVLFDVYEIKEAIKGAGTDEACLIEIFASRSNEHIRELSRAYKTEFQKTLEEAIRSDTSGHFQRLLISLSQGNRDESTNVDMSLVQRDVQELYAAGENRLGTDESKFNAILCSRSRAHLVAVFNEYQRMTGRDIEKSI 408          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA4_RAT (Annexin A4 OS=Rattus norvegicus GN=Anxa4 PE=1 SV=3)

HSP 1 Score: 108.612 bits (270), Expect = 3.621e-23
Identity = 78/221 (35.29%), Postives = 119/221 (53.85%), Query Frame = 2
Query:   83 SAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAE-RDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEEL--IRILTTRSKAQINATLNHYNDAFGNAXHKDLKADPMMNTS 736
            +A EDA+ L KA +G GT+E  II VLA RN AQR+ IR  Y  T G DLL+ L  ELSS+FE+ V+L  +TP    D      A K   +    L+EI  +R+  ++    Q Y  +Y +SLEED+   TS  F+++LV L +  R +G  ++  L R +A+ + +   +K +  +E+  + IL +R++      L H  D +     KD++      TS
Sbjct:   15 NATEDAQVLRKAMKGLGTDEDAIIGVLACRNTAQRQEIRTAYKSTIGRDLLEDLKSELSSNFEQ-VILGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRNPEEIRRINQTYQQQYGRSLEEDICSDTSFMFQRVLVSLTAGGRDEGNYLDDALVRQDAQDLYE-AGEKRWGTDEVKFLSILCSRNRNH----LLHVFDEYKRISQKDIEQSIKSETS 229          

HSP 2 Score: 67.781 bits (164), Expect = 7.084e-11
Identity = 50/226 (22.12%), Postives = 95/226 (42.04%), Query Frame = 2
Query:   77 TPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLAN------------EATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIRILTTRSKAQINATLNHYNDAFGNAXHKDLKAD 718
            TP+   D ++L +A +G GT+E  +I +LA RN  + + I + Y + YG  L + +  + S  F+R ++  T    +   YL +               KR  +     + I C+R+   L      Y    +K +E+ +   TSG F   L+ +V   R         L ++   +  D           LIR++ +R++  +     ++   +G + +  +K D
Sbjct:   85 TPTVLYDVQELRRAMKGAGTDEGCLIEILASRNPEEIRRINQTYQQQYGRSLEEDICSDTSFMFQRVLVSLTAGGRDEGNYLDDALVRQDAQDLYEAGEKRWGTDEVKFLSILCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKPAYFAERLYKSMKGLGTD--------DSTLIRVMVSRAEIDMLDIPANFKRVYGKSLYSFIKGD 302          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA4_PIG (Annexin A4 OS=Sus scrofa GN=ANXA4 PE=1 SV=2)

HSP 1 Score: 108.227 bits (269), Expect = 4.730e-23
Identity = 77/219 (35.16%), Postives = 117/219 (53.42%), Query Frame = 2
Query:   83 SAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAE-RDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIRILTTRSKAQINATLNHYNDAFGNAXHKDLKADPMMNTS 736
            +AAEDA+ L KA +G GT+E  IISVLA+R+ AQR+ IR  Y  T G DLL  L  ELS +FE+ V+L  +TP    D      A K   +    L+EI  +R+  ++    Q Y  +Y +SLE+D+   TS  F+++LV L +  R +G  ++  L R +A+ + +   +K +  +E ++ LT       N  L H  D +     KD++      TS
Sbjct:   15 NAAEDAQTLRKAMKGLGTDEDAIISVLAYRSTAQRQEIRTAYKSTIGRDLLDDLKSELSGNFEQ-VILGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRINQTYQLQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYE-AGEKKWGTDE-VKFLTVLCSRNRNHLL-HVFDEYKRISQKDIEQSIKSETS 229          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA4_MOUSE (Annexin A4 OS=Mus musculus GN=Anxa4 PE=2 SV=3)

HSP 1 Score: 107.457 bits (267), Expect = 8.068e-23
Identity = 75/221 (33.94%), Postives = 120/221 (54.30%), Query Frame = 2
Query:   83 SAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAE-RDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEEL--IRILTTRSKAQINATLNHYNDAFGNAXHKDLKADPMMNTS 736
            +A EDA+ L KA +G GT+E  II +LA+RN AQR+ IR  Y  T G DL++ L  ELSS+FE+ V+L  +TP    D      A K   +    L+EI  +R+  ++    Q Y  +Y +SLEED+   TS  F+++LV L +  R +G  ++  L + +A+ + +   +K +  +E+  + IL +R++      L H  D +     KD++      TS
Sbjct:   15 NATEDAQTLRKAMKGLGTDEDAIIGILAYRNTAQRQEIRSAYKSTIGRDLIEDLKSELSSNFEQ-VILGLMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRINQTYQQQYGRSLEEDICSDTSFMFQRVLVFLSAAGRDEGNYLDDALMKQDAQELYE-AGEKRWGTDEVKFLSILCSRNRNH----LLHVFDEYKRISQKDIEQSIKSETS 229          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA4_HUMAN (Annexin A4 OS=Homo sapiens GN=ANXA4 PE=1 SV=4)

HSP 1 Score: 106.301 bits (264), Expect = 1.797e-22
Identity = 75/219 (34.25%), Postives = 116/219 (52.97%), Query Frame = 2
Query:   83 SAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAE-RDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIRILTTRSKAQINATLNHYNDAFGNAXHKDLKADPMMNTS 736
            +A EDA+ L KA +G GT+E  IISVLA+RN AQR+ IR  Y  T G DL+  L  ELS +FE+ V++  +TP    D      A K   +    L+EI  +R+  ++    Q Y  +Y +SLE+D+   TS  F+++LV L +  R +G  ++  L R +A+ + +   +K +  +E ++ LT       N  L H  D +     KD++      TS
Sbjct:   15 NAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQ-VIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYE-AGEKKWGTDE-VKFLTVLCSRNRNHLL-HVFDEYKRISQKDIEQSIKSETS 229          
The following BLAST results are available for this feature:
BLAST of FC920697 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 85
Match NameE-valueIdentityDescription
ANXA6_HUMAN1.245e-2332.50Annexin A6 OS=Homo sapiens GN=ANXA6 PE=1 SV=3[more]
ANXA6_BOVIN1.626e-2334.50Annexin A6 OS=Bos taurus GN=ANXA6 PE=1 SV=2[more]
ANXA6_MOUSE2.123e-2332.50Annexin A6 OS=Mus musculus GN=Anxa6 PE=1 SV=2[more]
ANXA6_CHICK2.123e-2335.82Annexin A6 OS=Gallus gallus GN=ANXA6 PE=2 SV=1[more]
ANXA7_MOUSE2.773e-2331.46Annexin A7 OS=Mus musculus GN=Anxa7 PE=2 SV=1[more]
ANX11_MOUSE2.773e-2333.50Annexin A11 OS=Mus musculus GN=Anxa11 PE=1 SV=1[more]
ANXA4_RAT3.621e-2335.29Annexin A4 OS=Rattus norvegicus GN=Anxa4 PE=1 SV=3[more]
ANXA4_PIG4.730e-2335.16Annexin A4 OS=Sus scrofa GN=ANXA4 PE=1 SV=2[more]
ANXA4_MOUSE8.068e-2333.94Annexin A4 OS=Mus musculus GN=Anxa4 PE=2 SV=3[more]
ANXA4_HUMAN1.797e-2234.25Annexin A4 OS=Homo sapiens GN=ANXA4 PE=1 SV=4[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011H05EF RVDevelop1 Citrus clementina cDNA clone C32011H05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920697 ID=FC920697|Name=FC920697|organism=Citrus clementina|type=EST|length=741bp
GACTGCCTCGTCATTTTCTATTTTACAAAAACGCTGAAACAAATCGACAA
TGGCGACCCTTAAAGTGCCAACCCAGACCCCTTCTGCTGCTGAGGATGCT
GAGCAACTCCACAAAGCCTTCCAAGGATGGGGCACGAATGAGGCCCTCAT
TATATCTGTCTTGGCTCACAGAAATGCAGCTCAGCGCAAGTTGATTCGAG
AAATCTACAACGAAACTTATGGGGAAGACCTTCTTAAAGCACTGGACAAA
GAACTTTCAAGTGACTTTGAGAGATCTGTACTGCTATGGACATTGACTCC
TGCTGAGCGTGATGCTTATTTGGCAAATGAAGCGACAAAGAGATTGACTT
CAAGCAACTGGGTTCTCATGGAAATTGCCTGTACTAGATCTTCAAGAGAC
CTATTTGCTGCAAAGCAGGCCTACCATGCTCGTTACAAGAAATCCCTAGA
GGAAGATGTTGCATATCACACATCTGGGGACTTCCGCAAGCTTTTGGTTC
CTCTTGTGAGCACATTTCGATATGATGGAGGAGATGTGAACATGATGTTG
GCAAGAACTGAGGCTAAGATTATCCGTGACAAGATTTCAGACAAGGATTA
TGCTCATGAGGAGCTTATCAGGATTCTGACTACAAGGAGCAAGGCACAGA
TAAATGCGACCCTCAATCACTACAATGATGCTTTTGGAAATGCCATNCAC
AAGGATTTGAAGGCTGATCCCATGATGAATACCTCAACTGC
back to top