FC920697

Overview
NameFC920697
Unique NameFC920697
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length741
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15382 contig Ccv1_Contig15382:10..750. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA3_BOVIN (Annexin A3 OS=Bos taurus GN=ANXA3 PE=2 SV=3)

HSP 1 Score: 106.301 bits (264), Expect = 1.797e-22
Identity = 71/208 (34.13%), Postives = 112/208 (53.85%), Query Frame = 2
Query:   95 DAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEE--LIRILTTRSKAQINATLNHYNDAFGNAXHKDLK 712
            DAE + KA +G GT+E  +IS+L  R  AQR LI + Y    G++L   L  +LS  F+  ++     PA  DA    ++ K + ++   L+EI  TR+S+ +     AY+  YKKSL ++++  TSGDFRK L+ L +  R +   V+  LAR +A+I+ +   +K +  +E     IL  RS  Q+  T + Y     N   KD++
Sbjct:   23 DAEAIRKAIRGIGTDEKTLISILTERTNAQRLLIAKEYQALCGKELKDDLKGDLSGHFKHLMVALVTPPAVFDAKQLKKSMKGMGTNEDALIEILTTRTSKQMQEIGHAYYTAYKKSLGDEISSETSGDFRKALLILANGRRDESLKVDEQLARKDAQILYN-AGEKRWGTDEDAFTNILCLRSFPQLKLTFDEYR----NISQKDIE 225          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA6_RAT (Annexin A6 OS=Rattus norvegicus GN=Anxa6 PE=1 SV=2)

HSP 1 Score: 103.605 bits (257), Expect = 1.165e-21
Identity = 62/200 (31.00%), Postives = 105/200 (52.50%), Query Frame = 2
Query:   95 DAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKI-------SDKDYAHEELIRILTTRSKAQINATLNHY 673
            DA+ L KA +G GT+EA II ++  R+  QR+ IR+ +   +G DL+  L  E+S D  R +L   + PA  DA    +A +   +    L+EI  TR++ ++ A  +AY   Y KSLE+ ++  TSG F+++L+ L +  R +GG+ N   A+ +A++  + +        DK       + +L TRS   +      +
Sbjct:  368 DAKGLRKAMKGIGTDEATIIDIITQRSNVQRQQIRQTFKSHFGRDLMADLKSEISGDLARLILGLMMPPAHYDAKQLKKAMEGAGTDEKALIEILATRTNAEIRAINEAYKEDYHKSLEDALSSDTSGHFKRILISLATGNREEGGE-NRDQAQEDAQVAAEILEIADTPSGDKTSLETRFMTVLCTRSYPHLRRVFQEF 566          

HSP 2 Score: 86.2705 bits (212), Expect = 1.925e-16
Identity = 59/212 (27.83%), Postives = 104/212 (49.06%), Query Frame = 2
Query:   86 AAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHE-ELIRILTTRSKAQINATLNHYNDAFGNAXHKDLKAD 718
            A +DAE L+ A +G+G+++  I+ ++  R+  QR+ I + Y   YG+DL+  L  EL+  FER ++      A  DA    +A   + +    L+EI  +R++  +     AY   Y++ LE D+   TSG F+K+LV L+   R +   V+  L + + + + +    K    E + I IL  RSK  +    + Y    G      ++ +
Sbjct:   22 ANQDAEALYTAMKGFGSDKESILELITSRSNKQRQEICQSYKSLYGKDLIADLKYELTGKFERLIVNLMRPLAYCDAKEIKDAISGIGTDEKCLIEILASRTNEQIHQLVAAYKDAYERDLESDIIGDTSGHFQKMLVVLLQGTRENDDVVSEDLVQQDVQDLYEAGELKWGTDEAQFIYILGNRSKQHLRLVFDEYLKTTGKPIEASIRGE 233          

HSP 3 Score: 68.1662 bits (165), Expect = 5.424e-11
Identity = 42/142 (29.58%), Postives = 77/142 (54.23%), Query Frame = 2
Query:   92 EDAEQLHKAFQ-GWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLAN---EATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPL 505
            +D + L++A +  WGT+EA  I +L +R+    +L+ + Y +T G+ +  ++  ELS DFE+ +L           Y A    +A K L + +  L+ I  +RS  D+   ++ +  +Y+KSL   +   TSG+++K L+ L
Sbjct:  179 QDVQDLYEAGELKWGTDEAQFIYILGNRSKQHLRLVFDEYLKTTGKPIEASIRGELSGDFEKLMLAVVKCIRSTPEYFAERLFKAMKGLGTRDNTLIRIMVSRSELDMLDIREIFRTKYEKSLYSMIKNDTSGEYKKALLKL 320          

HSP 4 Score: 67.781 bits (164), Expect = 7.084e-11
Identity = 61/241 (25.31%), Postives = 106/241 (43.98%), Query Frame = 2
Query:   50 MATLKVPTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLT-----------PAERDAYLANEATK-------RLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIRILTTRSKAQINATLNHYNDAFGNAXHKDLKAD 718
            +A L +    P A  DA+QL KA +G GT+E  +I +LA R  A+ + I E Y E Y + L  AL  + S  F+R +L+   T            A+ DA +A E  +         TS     M + CTRS   L    Q +  +    +E  +    SGD +   V +V + +    +  +  A    K ++   +D+    + L R++ +RS+  +      + + +  + H+ ++ D
Sbjct:  425 LARLILGLMMPPAHYDAKQLKKAMEGAGTDEKALIEILATRTNAEIRAINEAYKEDYHKSLEDALSSDTSGHFKR-ILISLATGNREEGGENRDQAQEDAQVAAEILEIADTPSGDKTSLETRFMTVLCTRSYPHLRRVFQEFIKKTNYDIEHVIKKEMSGDVKDAFVAIVQSVK----NKPLFFADKLYKSMKGAGTDE----KTLTRVMVSRSEIDLLNIRREFIEKYDKSPHQAIEGD 656          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA4_CANFA (Annexin A4 OS=Canis familiaris GN=ANXA4 PE=1 SV=2)

HSP 1 Score: 103.605 bits (257), Expect = 1.165e-21
Identity = 77/224 (34.38%), Postives = 115/224 (51.34%), Query Frame = 2
Query:   68 PTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAE-RDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIRILTTRSKAQINATLNHYNDAFGNAXHKDLKADPMMNTS 736
            P    SA EDA+ L KA +G GT+E  IISVLA RN +QR+ IR  Y  T G DL+  L  ELS +FER V++  +TP    D      A K   +    L+EI  +R+  +L    Q Y  +Y +SLE+ +   TS  F+++LV L +  R +G  ++  L R +A+ + +   +K +  +E ++ LT       N  L H  D +     KD++      TS
Sbjct:   10 PASGFSATEDAQTLRKAMKGLGTDEDAIISVLAPRNTSQRQEIRTAYKSTIGRDLMDDLKSELSGNFER-VIVGMITPTVLYDVQELRRAMKGSGTDEGCLIEILASRTPEELRCINQTYQLQYGRSLEDVIRSDTSFMFQRVLVSLSAGGRDEGNFLDDALMRQDAQDLYE-AGEKKWGTDE-VKFLTVLCSRNRNHLL-HVFDEYKRISQKDIEQGIKSETS 229          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA4_BOVIN (Annexin A4 OS=Bos taurus GN=ANXA4 PE=1 SV=2)

HSP 1 Score: 103.605 bits (257), Expect = 1.165e-21
Identity = 74/219 (33.79%), Postives = 117/219 (53.42%), Query Frame = 2
Query:   83 SAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAE-RDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIRILTTRSKAQINATLNHYNDAFGNAXHKDLKADPMMNTS 736
            +AAEDA+ L KA +G GT+E  II+VLA+R+ AQR+ IR  Y  T G DL+  L  ELS +FE+ V+L  +TP    D     +A K   +    L+EI  +R+  ++    Q Y  +Y +SLE+D+   TS  F+++LV L +  R +   ++  L R +A+ + +   +K +  +E ++ LT       N  L H  D +     KD++      TS
Sbjct:   15 NAAEDAQTLRKAMKGLGTDEDAIINVLAYRSTAQRQEIRTAYKTTIGRDLMDDLKSELSGNFEQ-VILGMMTPTVLYDVQELRKAMKGAGTDEGCLIEILASRTPEEIRRINQTYQLQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDESNYLDDALMRQDAQDLYE-AGEKKWGTDE-VKFLTVLCSRNRNHLL-HVFDEYKRIAQKDIEQSIKSETS 229          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA8_RABIT (Annexin A8 OS=Oryctolagus cuniculus GN=ANXA8 PE=2 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.987e-21
Identity = 72/212 (33.96%), Postives = 107/212 (50.47%), Query Frame = 2
Query:   95 DAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYD-GGDVNMMLARTEAKII---RDKISDKDYAHEELIRILTTRSKAQINATLNHYNDAFGNAXHKDLKAD 718
            DAE L+KA +G GTNE  II VL  R++AQR+ I + +   +G DL + L  ELS  FER ++     P   +A   ++A K L +   V++EI  +R+   L    +AY   Y  SLEED+   TSG   ++LV L+   R D  G V+  LA  +A+ +    +KI   D    + I IL TRS   +      Y      +    +K++
Sbjct:   26 DAETLYKAMKGIGTNEQAIIDVLTRRSSAQRQQIAKSFKAQFGSDLTETLKSELSGKFERLIVALMYPPYRYEAKELHDAMKGLGTKEGVIIEILASRTKNQLQEIMKAYEEDYGSSLEEDIQADTSGYLERILVCLLQGSRDDVTGFVDPGLALQDAQDLYAAGEKICGTD--EMKFITILCTRSARHLMRVFEEYEKIANKSIEDSIKSE 235          

HSP 2 Score: 68.5514 bits (166), Expect = 4.153e-11
Identity = 60/236 (25.42%), Postives = 95/236 (40.25%), Query Frame = 2
Query:   59 LKVPTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAE----------------RDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIRILTTRSKAQINATLNHYNDAFGNAXHKDLKAD 718
            L V    P    +A++LH A +G GT E +II +LA R   Q + I + Y E YG  L + +  + S   ER +L+  L  +                 +D Y A E  K   +     + I CTRS+R L    + Y     KS+E+ +   T G   + ++ +V   R         L    A+ +   +         LIR + +RS+  +N    HY   +G      +  D
Sbjct:   86 LIVALMYPPYRYEAKELHDAMKGLGTKEGVIIEILASRTKNQLQEIMKAYEEDYGSSLEEDIQADTSGYLER-ILVCLLQGSRDDVTGFVDPGLALQDAQDLYAAGE--KICGTDEMKFITILCTRSARHLMRVFEEYEKIANKSIEDSIKSETHGSLEEAMLTIVKCTR--------NLHCYFAERLHYAMKGAGTLDGTLIRNIVSRSEIDLNLIKGHYKKMYGKTLSSMIMED 310          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXB9_DROME (Annexin-B9 OS=Drosophila melanogaster GN=AnnIX PE=1 SV=2)

HSP 1 Score: 101.679 bits (252), Expect = 4.427e-21
Identity = 73/219 (33.33%), Postives = 105/219 (47.95%), Query Frame = 2
Query:   68 PTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAER-DAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIR-ILTTRSKAQINATLNHYNDAFGNAXHKDLKAD 718
            P       EDA  L KA +G+GT+E  II +LA R   QR  I E +  +YG+DL+  L  EL   FE  V+L  +TP  +  A   ++A   L +    ++EI CT S+  +    Q Y   + KSLE D+   TSG F++L V LV   R +   V+   A  +A+ + D    +    E     IL TRS  Q+      Y +  GN   K +K +
Sbjct:   17 PADPFDPVEDAAILRKAMKGFGTDEKAIIEILARRGIVQRLEIAEAFKTSYGKDLISDLKSELGGKFE-DVILALMTPLPQFYAQELHDAISGLGTDEEAIIEILCTLSNYGIKTIAQFYEQSFGKSLESDLKGDTSGHFKRLCVSLVQGNRDENQGVDEAAAIADAQALHDAGEGQWGTDESTFNSILITRSYQQLRQIFLEYENLSGNDIEKAIKRE 234          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA8_BOVIN (Annexin A8 OS=Bos taurus GN=ANXA8 PE=2 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 5.782e-21
Identity = 70/212 (33.02%), Postives = 107/212 (50.47%), Query Frame = 2
Query:   95 DAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYD-GGDVNMMLARTEAKII---RDKISDKDYAHEELIRILTTRSKAQINATLNHYNDAFGNAXHKDLKAD 718
            DAE L+KA +G GTNE  II VL  R+ AQR+ I + +   +G+DL++ L  ELS  FER ++     P   +A    +A K + +   V++EI  +R+   L    +AY   Y  +LEED+   TSG   ++LV L+   R D  G V+  LA  +A+ +    +KI   D    + I IL TRS   +      Y      +    +K++
Sbjct:   26 DAETLYKAMKGIGTNEQAIIDVLTKRSNAQRQQIAKSFKAQFGKDLIETLKSELSGKFERLIIALMYPPYRYEAKELYDAMKGIGTKEGVIIEILASRTKNQLQEIMKAYEEDYGSNLEEDIKADTSGYLERILVCLLQGSRDDLSGYVDPGLALQDAQDLYAAGEKICGTD--EMKFITILCTRSATHLMRVFEEYEKIANKSIEDSIKSE 235          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANX12_HYDAT (Annexin-B12 OS=Hydra attenuata GN=ANXB12 PE=1 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 9.862e-21
Identity = 67/204 (32.84%), Postives = 106/204 (51.96%), Query Frame = 2
Query:   68 PTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIR-ILTTRSKAQINATLNHYN 676
            P  + ++ EDAE L KA +G GT+E  I  +LA R+ AQR+ I+  Y   +G+ L   L  ELS ++E + L     P E  A   + A K L +    L++I CT+S+  + A K A+   YK+ LE+++   TSG+F++LLV ++   R +   VN   A  +A  I      +    E     +L TRS  Q++   + Y+
Sbjct:    9 PHASFNSREDAETLRKAMKGIGTDEKSITHILATRSNAQRQQIKTDYTTLFGKHLEDELKSELSGNYEAAALALLRKPDEFLAEQLHAAMKGLGTDENALIDILCTQSNAQIHAIKAAFKLLYKEDLEKEIISETSGNFQRLLVSMLQGGRKEDEPVNAAHAAEDAAAIYQAGEGQIGTDESRFNAVLATRSYPQLHQIFHEYS 212          

HSP 2 Score: 74.7146 bits (182), Expect = 5.795e-13
Identity = 51/150 (34.00%), Postives = 81/150 (54.00%), Query Frame = 2
Query:   68 PTQTPSAAEDAEQLHKAFQGW-GTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLA---NEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPL 505
            P     AAEDA  +++A +G  GT+E+   +VLA R+  Q   I   Y++   + +L+A++ E S D +  +L    +   R AY A   + A K L +S+  L+ I  +RS  DL   K+ + A Y KSL E +A   SGD++ LL+ +
Sbjct:  164 PVNAAHAAEDAAAIYQAGEGQIGTDESRFNAVLATRSYPQLHQIFHEYSKISNKTILQAIENEFSGDIKNGLLAIVKSVENRFAYFAERLHHAMKGLGTSDKTLIRILVSRSEIDLANIKETFQAMYGKSLYEFIADDCSGDYKDLLLQI 313          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA8_RAT (Annexin A8 OS=Rattus norvegicus GN=Anxa8 PE=1 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.288e-20
Identity = 70/212 (33.02%), Postives = 106/212 (50.00%), Query Frame = 2
Query:   95 DAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYD-GGDVNMMLARTEAKIIR---DKISDKDYAHEELIRILTTRSKAQINATLNHYNDAFGNAXHKDLKAD 718
            DAE L+KA +G GTNE  II VL  R+  QR+ I + +   +G+DL + L  ELS  FER ++     P   +A   ++A K L +   V++EI  +R+   L    +AY   Y  +LEED+   TSG   ++LV L+   R D  G V+  LA  +A+ +    +KI   D    + I IL TRS   +      Y      +    +K++
Sbjct:   26 DAETLYKAMKGIGTNEQAIIDVLTKRSNVQRQQIAKSFKAQFGKDLTETLKSELSGKFERLIVALMYPPYRYEAKELHDAMKGLGTKEGVIIEILASRTKNQLREIMKAYEEDYGSTLEEDIQGDTSGYLERILVCLLQGCRDDVSGFVDPGLALQDAQDLHAAGEKILGTD--EMKFITILCTRSATHLMRVFEEYEKIANKSIEDSIKSE 235          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA1_CAVCU (Annexin A1 OS=Cavia cutleri GN=ANXA1 PE=1 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 2.197e-20
Identity = 71/207 (34.30%), Postives = 103/207 (49.76%), Query Frame = 2
Query:   68 PTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKII-----RDKISDKDYAHEELIRILTTRSKAQINATLNHY 673
            P  +  A+ D   LHKA    G +EA II +L  RN AQR+ I+  Y +  G+ L +AL K L+   E  VL    TPA+ DA     A K L +    L+EI  +R +R++    + Y    K+ L +D+   TSGDF+K L+ L    R +   VN  LA ++A+ +     R K +D +      I ILTTRS + +      Y
Sbjct:   38 PYPSFDASSDVAALHKAITVKGVDEATIIDILTKRNNAQRQQIKAAYLQEKGKPLDEALKKALTGHLEEVVLALLKTPAQLDADELRAAMKGLGTDEDTLIEILVSRKNREIKEINRVYRDELKRDLAKDITSDTSGDFQKALLSLAKGDRCEDLSVNDDLADSDARALYEAGERRKGTDVNV----FITILTTRSYSHLRRVFQKY 240          
The following BLAST results are available for this feature:
BLAST of FC920697 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 85
Match NameE-valueIdentityDescription
ANXA3_BOVIN1.797e-2234.13Annexin A3 OS=Bos taurus GN=ANXA3 PE=2 SV=3[more]
ANXA6_RAT1.165e-2131.00Annexin A6 OS=Rattus norvegicus GN=Anxa6 PE=1 SV=2[more]
ANXA4_CANFA1.165e-2134.38Annexin A4 OS=Canis familiaris GN=ANXA4 PE=1 SV=2[more]
ANXA4_BOVIN1.165e-2133.79Annexin A4 OS=Bos taurus GN=ANXA4 PE=1 SV=2[more]
ANXA8_RABIT1.987e-2133.96Annexin A8 OS=Oryctolagus cuniculus GN=ANXA8 PE=2 ... [more]
ANXB9_DROME4.427e-2133.33Annexin-B9 OS=Drosophila melanogaster GN=AnnIX PE=... [more]
ANXA8_BOVIN5.782e-2133.02Annexin A8 OS=Bos taurus GN=ANXA8 PE=2 SV=1[more]
ANX12_HYDAT9.862e-2132.84Annexin-B12 OS=Hydra attenuata GN=ANXB12 PE=1 SV=1[more]
ANXA8_RAT1.288e-2033.02Annexin A8 OS=Rattus norvegicus GN=Anxa8 PE=1 SV=1[more]
ANXA1_CAVCU2.197e-2034.30Annexin A1 OS=Cavia cutleri GN=ANXA1 PE=1 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011H05EF RVDevelop1 Citrus clementina cDNA clone C32011H05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920697 ID=FC920697|Name=FC920697|organism=Citrus clementina|type=EST|length=741bp
GACTGCCTCGTCATTTTCTATTTTACAAAAACGCTGAAACAAATCGACAA
TGGCGACCCTTAAAGTGCCAACCCAGACCCCTTCTGCTGCTGAGGATGCT
GAGCAACTCCACAAAGCCTTCCAAGGATGGGGCACGAATGAGGCCCTCAT
TATATCTGTCTTGGCTCACAGAAATGCAGCTCAGCGCAAGTTGATTCGAG
AAATCTACAACGAAACTTATGGGGAAGACCTTCTTAAAGCACTGGACAAA
GAACTTTCAAGTGACTTTGAGAGATCTGTACTGCTATGGACATTGACTCC
TGCTGAGCGTGATGCTTATTTGGCAAATGAAGCGACAAAGAGATTGACTT
CAAGCAACTGGGTTCTCATGGAAATTGCCTGTACTAGATCTTCAAGAGAC
CTATTTGCTGCAAAGCAGGCCTACCATGCTCGTTACAAGAAATCCCTAGA
GGAAGATGTTGCATATCACACATCTGGGGACTTCCGCAAGCTTTTGGTTC
CTCTTGTGAGCACATTTCGATATGATGGAGGAGATGTGAACATGATGTTG
GCAAGAACTGAGGCTAAGATTATCCGTGACAAGATTTCAGACAAGGATTA
TGCTCATGAGGAGCTTATCAGGATTCTGACTACAAGGAGCAAGGCACAGA
TAAATGCGACCCTCAATCACTACAATGATGCTTTTGGAAATGCCATNCAC
AAGGATTTGAAGGCTGATCCCATGATGAATACCTCAACTGC
back to top