FC920697

Overview
NameFC920697
Unique NameFC920697
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length741
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15382 contig Ccv1_Contig15382:10..750. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA8_HUMAN (Annexin A8 OS=Homo sapiens GN=ANXA8 PE=1 SV=3)

HSP 1 Score: 98.5969 bits (244), Expect = 3.748e-20
Identity = 70/212 (33.02%), Postives = 105/212 (49.53%), Query Frame = 2
Query:   95 DAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYD-GGDVNMMLARTEAKII---RDKISDKDYAHEELIRILTTRSKAQINATLNHYNDAFGNAXHKDLKAD 718
            DAE L+KA +G GTNE  II VL  R+  QR+ I + +   +G+DL + L  ELS  FER ++     P   +A   ++A K L +   V++EI  +R+   L    +AY   Y  SLEED+   TSG   ++LV L+   R D    V+  LA  +A+ +    +KI   D    + I IL TRS   +      Y      +    +K++
Sbjct:   26 DAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKDLTETLKSELSGKFERLIVALMYPPYRYEAKELHDAMKGLGTKEGVIIEILASRTKNQLREIMKAYEEDYGSSLEEDIQADTSGYLERILVCLLQGSRDDVSSFVDPGLALQDAQDLYAAGEKIRGTD--EMKFITILCTRSATHLLRVFEEYEKIANKSIEDSIKSE 235          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA7_DICDI (Annexin A7 OS=Dictyostelium discoideum GN=nxnA PE=1 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 3.748e-20
Identity = 68/204 (33.33%), Postives = 107/204 (52.45%), Query Frame = 2
Query:   65 VPTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHE-ELIRILTTRSKAQINATLNHY 673
            V T T     DAE L KA +G GTNE+ +I VLA+RN A+R+ I+  ++  Y +DL++ +  E S +FE+ ++     PA  D    + A     ++   ++EI  TRS+  +   KQ +  ++ KSL++ +    SGDF+KLL  L    R +   +N M    +A+ +      K    E E I+ILT+RS   I A  + Y
Sbjct:  156 VGTITHDCKHDAEVLRKAMKGIGTNESDLIKVLANRNWAEREQIKREFSAKYSKDLIQDIKSETSGNFEKCLVALLTEPAHFDVEQIHSACAGAGTNENTIIEILVTRSNVQMEYIKQIFKNKHGKSLKDRLESEASGDFKKLLEKLTEP-RDESPVINPMQVSKDAEDLYKAGEGKIGTDEKEFIKILTSRSLPHIAAVASEY 358          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA8_PANTR (Annexin A8 OS=Pan troglodytes GN=ANXA8 PE=2 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 4.895e-20
Identity = 70/212 (33.02%), Postives = 104/212 (49.06%), Query Frame = 2
Query:   95 DAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYD-GGDVNMMLARTEAKII---RDKISDKDYAHEELIRILTTRSKAQINATLNHYNDAFGNAXHKDLKAD 718
            DAE L+KA +G GTNE  II VL  R+  QR+ I + +   +G+DL + L  ELS  FER ++     P   +A   ++A K L +   V++EI  +R+   L    +AY   Y  SLEED+   TSG   ++LV L+   R D    V+  LA  +A  +    +KI   D    + I IL TRS   +      Y      +    +K++
Sbjct:   26 DAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKDLTETLKSELSGKFERLIVALMYPPYRYEAKELHDAMKSLGTKEGVIIEILASRTKNQLREIMKAYEEDYGSSLEEDIQADTSGYLERILVCLLQGSRDDVSSFVDPGLALQDAHDLYAAGEKIRGTD--EMKFITILCTRSATHLLRVFEEYEKIANKSIEDSIKSE 235          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA8_MOUSE (Annexin A8 OS=Mus musculus GN=Anxa8 PE=2 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 4.895e-20
Identity = 72/218 (33.03%), Postives = 107/218 (49.08%), Query Frame = 2
Query:   95 DAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYD-GGDVNMMLARTEAKIIR---DKISDKDYAHEELIRILTTRSKAQINATLNHY--------NDAFGNAXHKDLK 712
            DAE L+KA +G GTNE  II VL  R+  QR+ I + +   +G+DL + L  ELS  FER ++     P   +A   ++A K L +   V++EI  +R+   L    +AY   Y  +LEED+   TSG   ++LV L+   R D  G V+  L   +A+ +    +KI   D    + I IL TRS   +      Y         D+F +  H  L+
Sbjct:   26 DAETLYKAMKGIGTNEQAIIDVLTKRSNVQRQQIAKSFKAQFGKDLTETLKSELSGKFERLIVALMYPPYSYEAKELHDAMKGLGTKEGVIIEILASRTKNQLREIMKAYEEDYGSTLEEDIQGDTSGYLERILVCLLQGSRDDVSGFVDPGLVLQDAQALHEAGEKIMGTD--EMKFITILCTRSLTHLMRVFEEYEKIADKCIEDSFKSETHGSLE 241          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA1_PONAB (Annexin A1 OS=Pongo abelii GN=ANXA1 PE=2 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 4.895e-20
Identity = 69/203 (33.99%), Postives = 100/203 (49.26%), Query Frame = 2
Query:   68 PTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIR-ILTTRSKAQINATLNHY 673
            PT  PS+  D   LHKA    G +EA II VL  RN AQR+ I+  Y +  G+ L + L K L+   E  VL    TPA+ DA     A K L +    L+EI  +R+++++    + Y    K+ L +D+   TSGDFR  L+ L    R +   VN  LA ++A+ + +    +      +   ILTTRS  Q+      Y
Sbjct:   40 PTFNPSS--DVAALHKAIMVKGVDEATIIDVLTKRNNAQRQQIKAAYLQETGKPLDETLKKALTGHLEEVVLALLKTPAQFDADELRAAMKGLGTDEDTLIEILASRTNKEIRDINRVYREELKRDLAKDITSDTSGDFRNALLSLAKGDRSEDFGVNEDLADSDARALYEAGERRKGTDVNVFNTILTTRSYPQLRRVFQKY 240          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA1_PANTR (Annexin A1 OS=Pan troglodytes GN=ANXA1 PE=2 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 4.895e-20
Identity = 68/203 (33.50%), Postives = 100/203 (49.26%), Query Frame = 2
Query:   68 PTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIR-ILTTRSKAQINATLNHY 673
            PT  PS+  D   LHKA    G +EA II +L  RN AQR+ I+  Y +  G+ L + L K L+   E  VL    TPA+ DA     A K L +    L+EI  +R+++++    + Y    K+ L +D+   TSGDFR  L+ L    R +   VN  LA ++A+ + +    +      +   ILTTRS  Q+      Y
Sbjct:   40 PTFNPSS--DVAALHKAIMVKGVDEATIIDILTRRNNAQRQQIKAAYLQETGKPLDETLKKALTGHLEEVVLALLKTPAQFDADELRAAMKGLGTDEDTLIEILASRTNKEIRDINRVYREELKRDLAKDITSDTSGDFRNALLSLAKGDRSEDFGVNEDLADSDARALYEAGERRKGTDVNVFNTILTTRSYPQLRRVFQKY 240          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA1_BOVIN (Annexin A1 OS=Bos taurus GN=ANXA1 PE=2 SV=2)

HSP 1 Score: 98.2117 bits (243), Expect = 4.895e-20
Identity = 73/208 (35.10%), Postives = 103/208 (49.52%), Query Frame = 2
Query:   68 PTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKII-----RDKISDKDYAHEELIRILTTRSKAQINATLNHYN 676
            PT  PS+  D E LHKA    G +EA II +L  RN AQR+ I+  Y +  G+ L + L K L    E  VL    TPA+ DA     A K L +    L EI  +R++R++    + Y    K+ L +D+A  TSGD+ K L+ L    R +   VN  LA ++A+ +     R K +D +      I ILTTRS   +      Y+
Sbjct:   40 PTFNPSS--DVEALHKAITVKGVDEATIIEILTKRNNAQRQQIKAAYLQEKGKPLDEVLKKALLGHLEEVVLALLKTPAQFDAEELRAAMKGLGTDEDTLNEILASRTNREIREINRVYREELKRDLAKDIASDTSGDYEKALLSLAKGDRSEELAVNDDLADSDARALYEAGERRKGTDVNV----FITILTTRSYPHLRRVFQKYS 241          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA1_RABIT (Annexin A1 OS=Oryctolagus cuniculus GN=ANXA1 PE=1 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 6.392e-20
Identity = 68/204 (33.33%), Postives = 102/204 (50.00%), Query Frame = 2
Query:   68 PTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELI-RILTTRSKAQINATLNHYN 676
            P   PS+  D   LH+A    G +EA II +L  RN AQR+ I+  Y +  G+ L + L K L+   E  VL    TPA+ DA     A K L +    L+EI  +R+++++    + Y    K+ L +D+A  TSGDF+K L+ L    R +   VN  LA T+A+ + +    +  A   +   ILTTRS   +      Y+
Sbjct:   40 PAFNPSS--DVAALHQAIMVKGVDEATIIDILTKRNNAQRQQIKAAYLQEKGKPLDEVLKKALTGHLEEVVLALLKTPAQFDADELRAAMKGLGTDEDTLIEILASRNNKEIREINRVYREELKRDLAKDIASDTSGDFQKALLSLAKGDRSEDFGVNEDLADTDARALYEAGERRKGADVNVFTTILTTRSYLHLRRVFQKYS 241          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA1_HUMAN (Annexin A1 OS=Homo sapiens GN=ANXA1 PE=1 SV=2)

HSP 1 Score: 97.8265 bits (242), Expect = 6.392e-20
Identity = 68/203 (33.50%), Postives = 100/203 (49.26%), Query Frame = 2
Query:   68 PTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIR-ILTTRSKAQINATLNHY 673
            PT  PS+  D   LHKA    G +EA II +L  RN AQR+ I+  Y +  G+ L + L K L+   E  VL    TPA+ DA     A K L +    L+EI  +R+++++    + Y    K+ L +D+   TSGDFR  L+ L    R +   VN  LA ++A+ + +    +      +   ILTTRS  Q+      Y
Sbjct:   40 PTFNPSS--DVAALHKAIMVKGVDEATIIDILTKRNNAQRQQIKAAYLQETGKPLDETLKKALTGHLEEVVLALLKTPAQFDADELRAAMKGLGTDEDTLIEILASRTNKEIRDINRVYREELKRDLAKDITSDTSGDFRNALLSLAKGDRSEDFGVNEDLADSDARALYEAGERRKGTDVNVFNTILTTRSYPQLRRVFQKY 240          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANX11_DROME (Annexin-B11 OS=Drosophila melanogaster GN=Anxb11 PE=1 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 6.392e-20
Identity = 66/221 (29.86%), Postives = 114/221 (51.58%), Query Frame = 2
Query:   65 VPTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLA--NEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIR-ILTTRSKAQINATLNHYNDAFGNAXHKDLKAD 718
            VP     A +DA  L KA +G+GT+E  +I+++  R+  QR+ I+  +   +G+DL++ +  E S +FE+ +L+  L P   D Y A  N+A   L +   VL+EI CT S+ ++   K  Y   Y   LE ++   TSG+F++LL  L +  R + G V+ + A+ +A+ +      +    E +   IL  R+  Q+      Y    G++  K +K +
Sbjct:   10 VPAANFDAVKDAHDLRKAMKGFGTDEDALINIICRRSNEQRQEIQRQFKTHFGKDLIEDIKSETSGNFEK-LLVGLLRPIV-DYYCAELNDAMAGLGTDEEVLIEILCTLSNMEINTIKNQYLRLYGAHLESELKSETSGNFKRLLTSLCTAARDESGRVDPVAAKNDARELLKAGELRVGTDESMFNMILCQRNYQQLKLIFQEYEGMTGHSLEKAIKKE 228          
The following BLAST results are available for this feature:
BLAST of FC920697 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 85
Match NameE-valueIdentityDescription
ANXA8_HUMAN3.748e-2033.02Annexin A8 OS=Homo sapiens GN=ANXA8 PE=1 SV=3[more]
ANXA7_DICDI3.748e-2033.33Annexin A7 OS=Dictyostelium discoideum GN=nxnA PE=... [more]
ANXA8_PANTR4.895e-2033.02Annexin A8 OS=Pan troglodytes GN=ANXA8 PE=2 SV=1[more]
ANXA8_MOUSE4.895e-2033.03Annexin A8 OS=Mus musculus GN=Anxa8 PE=2 SV=1[more]
ANXA1_PONAB4.895e-2033.99Annexin A1 OS=Pongo abelii GN=ANXA1 PE=2 SV=1[more]
ANXA1_PANTR4.895e-2033.50Annexin A1 OS=Pan troglodytes GN=ANXA1 PE=2 SV=1[more]
ANXA1_BOVIN4.895e-2035.10Annexin A1 OS=Bos taurus GN=ANXA1 PE=2 SV=2[more]
ANXA1_RABIT6.392e-2033.33Annexin A1 OS=Oryctolagus cuniculus GN=ANXA1 PE=1 ... [more]
ANXA1_HUMAN6.392e-2033.50Annexin A1 OS=Homo sapiens GN=ANXA1 PE=1 SV=2[more]
ANX11_DROME6.392e-2029.86Annexin-B11 OS=Drosophila melanogaster GN=Anxb11 P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011H05EF RVDevelop1 Citrus clementina cDNA clone C32011H05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920697 ID=FC920697|Name=FC920697|organism=Citrus clementina|type=EST|length=741bp
GACTGCCTCGTCATTTTCTATTTTACAAAAACGCTGAAACAAATCGACAA
TGGCGACCCTTAAAGTGCCAACCCAGACCCCTTCTGCTGCTGAGGATGCT
GAGCAACTCCACAAAGCCTTCCAAGGATGGGGCACGAATGAGGCCCTCAT
TATATCTGTCTTGGCTCACAGAAATGCAGCTCAGCGCAAGTTGATTCGAG
AAATCTACAACGAAACTTATGGGGAAGACCTTCTTAAAGCACTGGACAAA
GAACTTTCAAGTGACTTTGAGAGATCTGTACTGCTATGGACATTGACTCC
TGCTGAGCGTGATGCTTATTTGGCAAATGAAGCGACAAAGAGATTGACTT
CAAGCAACTGGGTTCTCATGGAAATTGCCTGTACTAGATCTTCAAGAGAC
CTATTTGCTGCAAAGCAGGCCTACCATGCTCGTTACAAGAAATCCCTAGA
GGAAGATGTTGCATATCACACATCTGGGGACTTCCGCAAGCTTTTGGTTC
CTCTTGTGAGCACATTTCGATATGATGGAGGAGATGTGAACATGATGTTG
GCAAGAACTGAGGCTAAGATTATCCGTGACAAGATTTCAGACAAGGATTA
TGCTCATGAGGAGCTTATCAGGATTCTGACTACAAGGAGCAAGGCACAGA
TAAATGCGACCCTCAATCACTACAATGATGCTTTTGGAAATGCCATNCAC
AAGGATTTGAAGGCTGATCCCATGATGAATACCTCAACTGC
back to top