FC924894

Overview
NameFC924894
Unique NameFC924894
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length725
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig1792 contig Ccv1_Contig1792:2..726. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC924894 vs. ExPASy Swiss-Prot
Match: SLU7_EMENI (Pre-mRNA-splicing factor slu7 OS=Emericella nidulans GN=slu7 PE=3 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.086e-16
Identity = 72/221 (32.58%), Postives = 100/221 (45.25%), Query Frame = 3
Query:  105 PASVGSKSTVDWEEINTHVPLYMKHAPWYAKSE--VPDNLKHQRKQKESLQSNINLCYDRGAKTFQA-D*YRKGACENCEAMSHNANSIMERPRKRRAILTNMRIAADEKIEKIVM----IQQSMPVMSVRDMKLITKMV*SLMRVTLRILPQVKKGVCGN----------------------GSGITGTNRDLRIREDIPKYLLNLDENSAYYDPKIRSM 680
            PA V SK      E N ++P ++   P+Y   +    D L+HQR  K++   +    Y+RG +   A   YRKGACENC AM+H A   + RPRK  A  T   I ADE I+ + +     +         + + + +    L R  L+   ++ KG                          G   +   R+LRIRED  KYLLNLD +SA YDPK R M
Sbjct:    5 PADVASK------ERNEYIPAFISKKPFYIDDDDTANDYLEHQRLHKQTTDQS--KWYERGKRAGPAATKYRKGACENCGAMTHKAKECLSRPRKHGAKWTGKDIQADEVIQNVDLGWDAKRDRWNGYDAAEYRQVVEEYEELER--LKRQAKLTKGETQTTNDGLDDEAPEQEARYAEESDMGRQQSTATRNLRIREDTAKYLLNLDLDSAKYDPKTRRM 215          
BLAST of FC924894 vs. ExPASy Swiss-Prot
Match: SLU7_SCHPO (Pre-mRNA-splicing factor SLU7 OS=Schizosaccharomyces pombe GN=slu7 PE=1 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.200e-15
Identity = 67/203 (33.00%), Postives = 91/203 (44.83%), Query Frame = 3
Query:  150 NTHVPLYMKHAPWYAKSE-VPDNLKHQRKQKESLQSNINLC-----YDRGAKTFQA-D*YRKGACENCEAMSHNANSIMERPRKRRAILTNMRIAADEKIEKIVMI----QQSMPVMSVRDMKLITKMV*SLMRVTLR------------ILPQVKKGVCGNGSGITGTNRDLRIREDIPKYLLNLDENSAYYDPKIRSMRED 689
            N ++P ++  APWYA+ +   + L HQR  K+   S          Y RG K   A   YRKGACENC AMSH     MERPRKR A  T   I ADE I+ I +     +         D K + +    L  +  +            +       V G+    + T   LR+RED+  Y L  D  +  Y+PK RSMR++
Sbjct:   49 NPYIPKFISTAPWYAQDDDAVERLAHQRIGKKETPSGGRSSIEGSWYVRGKKLGPAATKYRKGACENCGAMSHKVKDCMERPRKRGARWTGEDIQADEVIQDINVSWDAKRDRWNGYDATDYKKVIERYEKLDELQNKGEENRDASENSAVKASRNSTVSGSEDSASITTPSLRMREDVVAY-LRADNKNLQYEPKSRSMRDE 250          
BLAST of FC924894 vs. ExPASy Swiss-Prot
Match: SLU7_NEUCR (Pre-mRNA-splicing factor slu-7 OS=Neurospora crassa GN=slu-7 PE=3 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 2.047e-15
Identity = 73/225 (32.44%), Postives = 102/225 (45.33%), Query Frame = 3
Query:  102 APASVGSKST---VDWEEINTHVPLYMKHAPWYAK---SEVPDNLKHQR--KQKESLQSNINLCYDRGAKTFQA-D*YRKGACENCEAMSHNANSIMERPRKRRAILTNMRIAADEKIEKIVM-IQQSMPVMSVRDMKLITKMV*--SLMRVTLRILPQVKKGVCGNG--------SGI------------TGTNRDLRIREDIPKYLLNLDENSAYYDPKIRSM 680
            AP+S     T      +E N ++P Y+   P+Y     +E  D+L HQR  +Q+E   +       RG K   A   + KGACENC AM H     +ERPRK  A  T   I AD  +  + +  +    V S  D K   ++V   +++    R L   +K   G G        SG               T + +RIRED  KYLLNLD +SA Y+PK R++
Sbjct:   15 APSSTDKSETGAGAARKEDNIYIPSYISKQPFYVSGLDNEEGDSLLHQRARQQEEDKAAQAAALLARGKKAGPARTKWVKGACENCGAMGHKKKDCLERPRKFGAKATGKDIQADRIVRDVKLGYEAKRDVYSAYDPKQYMEVVEEYNMLEEARRALQGDQKTPDGEGADGPEDDKSGFKYDEESDMGRDRATTKQSMRIREDTAKYLLNLDSDSAKYNPKKRAL 239          
BLAST of FC924894 vs. ExPASy Swiss-Prot
Match: SLU7_RAT (Pre-mRNA-splicing factor SLU7 OS=Rattus norvegicus GN=Slu7 PE=2 SV=2)

HSP 1 Score: 79.7221 bits (195), Expect = 1.733e-14
Identity = 48/117 (41.03%), Postives = 59/117 (50.43%), Query Frame = 3
Query:  102 APASVGSKSTVDWEEINTHVPLYMKHAPWYAKSEVPDNLKHQRKQKESLQ--SNINLCYDRGAKTFQ-AD*YRKGACENCEAMSHNANSIMERPRKRRAILTNMRIAADEKIEKIVM 443
            APA V  +     ++IN H+P Y+   PWY        LKHQR Q E  +  S+    Y RG K       YRKGACENC AM+H      ERPR+  A  T   IA DE I+  +M
Sbjct:   48 APAEVDEEG----KDINPHIPQYISSVPWYIDPSKRPTLKHQRPQPEKQKQFSSSGEWYKRGVKENSITTKYRKGACENCGAMTHKRKDCFERPRRVGAKFTGTNIAPDEHIQPQLM 160          
BLAST of FC924894 vs. ExPASy Swiss-Prot
Match: SLU7_BOVIN (Pre-mRNA-splicing factor SLU7 OS=Bos taurus GN=SLU7 PE=2 SV=2)

HSP 1 Score: 79.7221 bits (195), Expect = 1.733e-14
Identity = 47/117 (40.17%), Postives = 59/117 (50.43%), Query Frame = 3
Query:  102 APASVGSKSTVDWEEINTHVPLYMKHAPWYAKSEVPDNLKHQRKQ--KESLQSNINLCYDRGAKTFQ-AD*YRKGACENCEAMSHNANSIMERPRKRRAILTNMRIAADEKIEKIVM 443
            APA V  +     ++IN H+P Y+   PWY        LKHQR Q  K+   S+    Y RG K       YRKGACENC AM+H      ERPR+  A  T   IA DE ++  +M
Sbjct:   48 APAEVDEEG----KDINPHIPQYISSVPWYIDPSKRPTLKHQRPQPEKQKQYSSSGEWYKRGVKENSITTKYRKGACENCGAMTHKKKDCFERPRRVGAKFTGTNIAPDEHVQPQLM 160          
BLAST of FC924894 vs. ExPASy Swiss-Prot
Match: SLU7_MOUSE (Pre-mRNA-splicing factor SLU7 OS=Mus musculus GN=Slu7 PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 2.264e-14
Identity = 47/117 (40.17%), Postives = 59/117 (50.43%), Query Frame = 3
Query:  102 APASVGSKSTVDWEEINTHVPLYMKHAPWYAKSEVPDNLKHQRKQKESLQ--SNINLCYDRGAKTFQ-AD*YRKGACENCEAMSHNANSIMERPRKRRAILTNMRIAADEKIEKIVM 443
            APA V  +     ++IN H+P Y+   PWY        LKHQR Q E  +  S+    Y RG K       YRKGACENC AM+H      ERPR+  A  T   IA DE ++  +M
Sbjct:   48 APAEVDEEG----KDINPHIPQYISSVPWYIDPSKRPTLKHQRPQPEKQKQFSSSGEWYKRGVKENSITTKYRKGACENCGAMTHKRKDCFERPRRVGAKFTGTNIAPDEHVQPQLM 160          
BLAST of FC924894 vs. ExPASy Swiss-Prot
Match: SLU7_MACFA (Pre-mRNA-splicing factor SLU7 OS=Macaca fascicularis GN=SLU7 PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.956e-14
Identity = 47/117 (40.17%), Postives = 59/117 (50.43%), Query Frame = 3
Query:  102 APASVGSKSTVDWEEINTHVPLYMKHAPWYAKSEVPDNLKHQRKQKESLQ--SNINLCYDRGAKTFQA-D*YRKGACENCEAMSHNANSIMERPRKRRAILTNMRIAADEKIEKIVM 443
            APA V  +     ++IN H+P Y+   PWY        LKHQR Q E  +  S+    Y RG K       YRKGACENC AM+H      ERPR+  A  T   IA DE ++  +M
Sbjct:   48 APAEVDEEG----KDINPHIPQYISSVPWYIDPSKRPTLKHQRPQPEKQKQFSSSGEWYKRGVKENSIITKYRKGACENCGAMTHKKKDCFERPRRVGAKFTGTNIAPDEHVQPQLM 160          
BLAST of FC924894 vs. ExPASy Swiss-Prot
Match: SLU7_HUMAN (Pre-mRNA-splicing factor SLU7 OS=Homo sapiens GN=SLU7 PE=1 SV=2)

HSP 1 Score: 78.9518 bits (193), Expect = 2.956e-14
Identity = 47/117 (40.17%), Postives = 59/117 (50.43%), Query Frame = 3
Query:  102 APASVGSKSTVDWEEINTHVPLYMKHAPWYAKSEVPDNLKHQRKQKESLQ--SNINLCYDRGAKTFQA-D*YRKGACENCEAMSHNANSIMERPRKRRAILTNMRIAADEKIEKIVM 443
            APA V  +     ++IN H+P Y+   PWY        LKHQR Q E  +  S+    Y RG K       YRKGACENC AM+H      ERPR+  A  T   IA DE ++  +M
Sbjct:   48 APAEVDEEG----KDINPHIPQYISSVPWYIDPSKRPTLKHQRPQPEKQKQFSSSGEWYKRGVKENSIITKYRKGACENCGAMTHKKKDCFERPRRVGAKFTGTNIAPDEHVQPQLM 160          
BLAST of FC924894 vs. ExPASy Swiss-Prot
Match: SLU7_DICDI (Pre-mRNA-splicing factor slu7 OS=Dictyostelium discoideum GN=slu7 PE=2 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 5.043e-14
Identity = 50/114 (43.86%), Postives = 64/114 (56.14%), Query Frame = 3
Query:  102 APASVGSKSTVDWEEINTHVPLYMKHAPWYAKSEVPDNLKHQRK-QKESLQSNINLCYDRGAKTFQA-D*YRKGACENCEAMSHNANSIMERPRKRRAILTNMRIAADEKIEKI 437
            APA +  +     +EIN H+P Y+  APWY  +  P +LKHQR   K+ +       Y RGA T +A   +RKGACENC AM+H      ERPRK  A  TN  I  DE I+K+
Sbjct:   29 APAELDEEG----KEINPHIPEYILKAPWYLNANKP-SLKHQRGVTKKEMDKG---WYLRGATTGEAATKFRKGACENCGAMTHKTKDCCERPRKLGAKFTNDDIKPDEVIQKL 134          
BLAST of FC924894 vs. ExPASy Swiss-Prot
Match: SLU7_DANRE (Pre-mRNA-splicing factor SLU7 OS=Danio rerio GN=slu7 PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 2.503e-13
Identity = 49/129 (37.98%), Postives = 65/129 (50.39%), Query Frame = 3
Query:  102 APASVGSKSTVDWEEINTHVPLYMKHAPWYAKSEVPDNLKHQRKQKESLQ--SNINLCYDRGAKTFQAD*-YRKGACENCEAMSHNANSIMERPRKRRAILTNMRIAADEKIEKIVMIQQSMPVMSVRD 479
            APA V  +     ++IN H+P Y+   PWY        LKHQR Q+E+    + I   Y RG +    +  YRKGACENC A++H     +ERPRK  A  +   IA DE  +    +Q SM     RD
Sbjct:   41 APAEVDEEG----KDINPHIPQYISSVPWYIDPSKRPTLKHQRPQEENQSKFAPIGDWYKRGVQEKSVNTKYRKGACENCGALTHKKKDCLERPRKVGAKFSGTGIAPDEHQQ----VQLSMDYDGKRD 161          
The following BLAST results are available for this feature:
BLAST of FC924894 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 21
Match NameE-valueIdentityDescription
SLU7_EMENI1.086e-1632.58Pre-mRNA-splicing factor slu7 OS=Emericella nidula... [more]
SLU7_SCHPO1.200e-1533.00Pre-mRNA-splicing factor SLU7 OS=Schizosaccharomyc... [more]
SLU7_NEUCR2.047e-1532.44Pre-mRNA-splicing factor slu-7 OS=Neurospora crass... [more]
SLU7_RAT1.733e-1441.03Pre-mRNA-splicing factor SLU7 OS=Rattus norvegicus... [more]
SLU7_BOVIN1.733e-1440.17Pre-mRNA-splicing factor SLU7 OS=Bos taurus GN=SLU... [more]
SLU7_MOUSE2.264e-1440.17Pre-mRNA-splicing factor SLU7 OS=Mus musculus GN=S... [more]
SLU7_MACFA2.956e-1440.17Pre-mRNA-splicing factor SLU7 OS=Macaca fascicular... [more]
SLU7_HUMAN2.956e-1440.17Pre-mRNA-splicing factor SLU7 OS=Homo sapiens GN=S... [more]
SLU7_DICDI5.043e-1443.86Pre-mRNA-splicing factor slu7 OS=Dictyostelium dis... [more]
SLU7_DANRE2.503e-1337.98Pre-mRNA-splicing factor SLU7 OS=Danio rerio GN=sl... [more]

Pages

back to top
Libraries
Library NameType
TFcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAP1YL08FM1 TF Citrus clementina cDNA clone KN0AAP1YL08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC924894 ID=FC924894|Name=FC924894|organism=Citrus clementina|type=EST|length=725bp
AATCTCCATACGGATGCTAGGGTTAGTTTTTAGTTGTCGCCTTCTTCAAA
ATTAATCTTCTAATAAGTGTTGGCTCTAGGGTTTGCAATCTCATCGAGAT
GGCTCCTGCTTCAGTGGGATCCAAATCAACGGTAGATTGGGAAGAAATCA
ACACACATGTTCCTCTGTATATGAAGCATGCGCCTTGGTATGCAAAGTCT
GAGGTACCAGATAACTTGAAACACCAAAGAAAACAGAAAGAATCACTTCA
GAGCAACATAAACTTGTGTTATGATAGAGGTGCCAAAACTTTCCAGGCGG
ACTAGTACAGGAAAGGAGCGTGTGAAAACTGCGAAGCAATGTCACATAAT
GCTAATTCAATCATGGAAAGGCCGAGAAAAAGAAGAGCAATATTGACAAA
CATGCGCATTGCAGCAGATGAAAAGATAGAGAAGATTGTTATGATCCAGC
AAAGTATGCCCGTGATGTCAGTAAGAGACATGAAGCTTATAACGAAGATG
GTTTGAAGCTTGATGAGAGTGACACTACGAATTTTGCCCCAAGTTAAGAA
GGGTGTTTGTGGTAATGGCAGTGGAATCACGGGAACTAATAGAGATTTGC
GTATTCGTGAAGATATACCTAAGTATCTCCTGAATCTTGATGAAAATTCC
GCATATTATGATCCAAAAATTCGGTCTATGCGGGAGGATCTCAACCCTGA
TGACAATCCGAATGAAAAGTTCTAT
back to top