FC924894

Overview
NameFC924894
Unique NameFC924894
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length725
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig1792 contig Ccv1_Contig1792:2..726. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC924894 vs. ExPASy Swiss-Prot
Match: SLU7_XENLA (Pre-mRNA-splicing factor SLU7 OS=Xenopus laevis GN=slu7 PE=2 SV=2)

HSP 1 Score: 74.3294 bits (181), Expect = 7.282e-13
Identity = 43/118 (36.44%), Postives = 61/118 (51.69%), Query Frame = 3
Query:  102 APASVGSKSTVDWEEINTHVPLYMKHAPWYAKSEVPDNLKHQRKQKESLQ--SNINLCYDRGAKTFQ-AD*YRKGACENCEAMSHNANSIMERPRKRRAILTNMRIAADEKIEKIVMI 446
            APA V  +     ++IN H+P Y+   PWY        LKHQR Q E  +  S ++  Y +G K       YR+GACENC +++H      ERPR+  A  T + IA DE  +  +M+
Sbjct:   45 APAEVDEEG----KDINPHIPQYISSVPWYVDPSKRPTLKHQRPQDEKQKYFSQMDEWYKKGVKEGSITTKYRQGACENCGSLTHKKKDCFERPRRVGARFTGVSIAPDEYEQPQLML 158          
The following BLAST results are available for this feature:
BLAST of FC924894 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 21
Match NameE-valueIdentityDescription
SLU7_XENLA7.282e-1336.44Pre-mRNA-splicing factor SLU7 OS=Xenopus laevis GN... [more]

Pages

back to top
Libraries
Library NameType
TFcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAP1YL08FM1 TF Citrus clementina cDNA clone KN0AAP1YL08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC924894 ID=FC924894|Name=FC924894|organism=Citrus clementina|type=EST|length=725bp
AATCTCCATACGGATGCTAGGGTTAGTTTTTAGTTGTCGCCTTCTTCAAA
ATTAATCTTCTAATAAGTGTTGGCTCTAGGGTTTGCAATCTCATCGAGAT
GGCTCCTGCTTCAGTGGGATCCAAATCAACGGTAGATTGGGAAGAAATCA
ACACACATGTTCCTCTGTATATGAAGCATGCGCCTTGGTATGCAAAGTCT
GAGGTACCAGATAACTTGAAACACCAAAGAAAACAGAAAGAATCACTTCA
GAGCAACATAAACTTGTGTTATGATAGAGGTGCCAAAACTTTCCAGGCGG
ACTAGTACAGGAAAGGAGCGTGTGAAAACTGCGAAGCAATGTCACATAAT
GCTAATTCAATCATGGAAAGGCCGAGAAAAAGAAGAGCAATATTGACAAA
CATGCGCATTGCAGCAGATGAAAAGATAGAGAAGATTGTTATGATCCAGC
AAAGTATGCCCGTGATGTCAGTAAGAGACATGAAGCTTATAACGAAGATG
GTTTGAAGCTTGATGAGAGTGACACTACGAATTTTGCCCCAAGTTAAGAA
GGGTGTTTGTGGTAATGGCAGTGGAATCACGGGAACTAATAGAGATTTGC
GTATTCGTGAAGATATACCTAAGTATCTCCTGAATCTTGATGAAAATTCC
GCATATTATGATCCAAAAATTCGGTCTATGCGGGAGGATCTCAACCCTGA
TGACAATCCGAATGAAAAGTTCTAT
back to top