FC928858

Overview
NameFC928858
Unique NameFC928858
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length866
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9258 contig Ccv1_Contig9258:11..876. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC928858 vs. ExPASy Swiss-Prot
Match: PPR40_ARATH (Pentatricopeptide repeat-containing protein At1g13040, mitochondrial OS=Arabidopsis thaliana GN=At1g13040 PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 8.845e-14
Identity = 39/156 (25.00%), Postives = 76/156 (48.72%), Query Frame = 1
Query:   28 DTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNE 495
            D  +Y T I+  C+     +A  LF  +R     +++ +Y+ LI    + G   +A +L   +    L  D + Y  ++  LC  G +DKA+ +F DM    + PD +++N+L+ G  R+   ++ ++L   M  +   PD  T   ++  L++ +
Sbjct:  324 DVVSYSTLIETFCRASNTRKAYRLFEEMRQKGMVMNVVTYTSLIKAFLREGNSSVAKKLLDQMTELGLSPDRIFYTTILDHLCKSGNVDKAYGVFNDMIEHEITPDAISYNSLISGLCRSGRVTEAIKLFEDMKGKECCPDELTFKFIIGGLIRGK 479          

HSP 2 Score: 72.0182 bits (175), Expect = 4.853e-12
Identity = 45/168 (26.79%), Postives = 81/168 (48.21%), Query Frame = 1
Query:    7 RRHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEISLNS 510
            R+ G+  +   Y + I    + G    A +L   +  L    D   Y+ ++D LCKSG +  A+ +F+ +    +  D ++YN +I  LC  G++ +A  LF DM+ K   PD + F  ++ G IR  + S   ++  +M ++    D      V D L+K   S+++
Sbjct:  352 RQKGMVMNVVTYTSLIKAFLREGNSSVAKKLLDQMTELGLSPDRIFYTTILDHLCKSGNVDKAYGVFNDMIEHEITPDAISYNSLISGLCRSGRVTEAIKLFEDMKGKECCPDELTFKFIIGGLIRGKKLSAAYKVWDQMMDKGFTLDRD----VSDTLIKASCSMSA 515          
BLAST of FC928858 vs. ExPASy Swiss-Prot
Match: PP447_ARATH (Putative pentatricopeptide repeat-containing protein At5g65820 OS=Arabidopsis thaliana GN=At5g65820 PE=3 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 8.845e-14
Identity = 45/158 (28.48%), Postives = 76/158 (48.10%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            G   D   Y   + G    G + +A +L R +R    E +   Y+ LI  LCK  R++ A ++F  + R    ADVVTY  ++   C  GK+DK + +  DM  KG+ P  + +  +M+   +     + +EL+ +M +    PD    ++V+ L  K
Sbjct:  282 GFEPDIVDYTNLLSGYANAGKMADAYDLLRDMRRRGFEPNANCYTVLIQALCKVDRMEEAMKVFVEMERYECEADVVTYTALVSGFCKWGKIDKCYIVLDDMIKKGLMPSELTYMHIMVAHEKKESFEECLELMEKMRQIEYHPDIGIYNVVIRLACK 439          
BLAST of FC928858 vs. ExPASy Swiss-Prot
Match: PP325_ARATH (Pentatricopeptide repeat-containing protein At4g19440, chloroplastic OS=Arabidopsis thaliana GN=At4g19440 PE=2 SV=2)

HSP 1 Score: 77.7962 bits (190), Expect = 8.845e-14
Identity = 43/150 (28.67%), Postives = 76/150 (50.67%), Query Frame = 1
Query:   46 TFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNE 495
            T I GLCK+G   +ALEL+         +D R+ + L+ GLC++G+L  A+ +   +     + D V+YN +I   C   K+D+A     +M  +G+ PD   ++ L+ G    N+  + ++         ++PD  T S+++D   K E
Sbjct:  488 TLISGLCKHGKHSKALELWFQFLNKGFVVDTRTSNALLHGLCEAGKLDEAFRIQKEILGRGCVMDRVSYNTLISGCCGKKKLDEAFMFLDEMVKRGLKPDNYTYSILICGLFNMNKVEEAIQFWDDCKRNGMLPDVYTYSVMIDGCCKAE 637          

HSP 2 Score: 72.0182 bits (175), Expect = 4.853e-12
Identity = 43/156 (27.56%), Postives = 76/156 (48.72%), Query Frame = 1
Query:    7 RRHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            +R+G+  D + Y   IDG CK     E  E F  +     + +   Y+ LI   C+SGRL +A EL   +    +  +  TY  +I  +    ++++A  LF +M  +G+ P+   +  L+ G  +  +  KV  LL  M  +NV P+  T ++++
Sbjct:  615 KRNGMLPDVYTYSVMIDGCCKAERTEEGQEFFDEMMSKNVQPNTVVYNHLIRAYCRSGRLSMALELREDMKHKGISPNSATYTSLIKGMSIISRVEEAKLLFEEMRMEGLEPNVFHYTALIDGYGKLGQMVKVECLLREMHSKNVHPNKITYTVMI 770          

HSP 3 Score: 69.3218 bits (168), Expect = 3.146e-11
Identity = 40/153 (26.14%), Postives = 73/153 (47.71%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            G   D  +Y T I G C    + EA      +     + D  +YS LI GL    +++ A + +    R  ++ DV TY++MI   C   + ++  + F +M +K V P+ V +N L+    R+   S  +EL   M  + + P+++T + ++
Sbjct:  548 GCVMDRVSYNTLISGCCGKKKLDEAFMFLDEMVKRGLKPDNYTYSILICGLFNMNKVEEAIQFWDDCKRNGMLPDVYTYSVMIDGCCKAERTEEGQEFFDEMMSKNVQPNTVVYNHLIRAYCRSGRLSMALELREDMKHKGISPNSATYTSLI 700          
BLAST of FC928858 vs. ExPASy Swiss-Prot
Match: PP431_ARATH (Pentatricopeptide repeat-containing protein At5g55740, chloroplastic OS=Arabidopsis thaliana GN=CRR21 PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.155e-13
Identity = 42/155 (27.10%), Postives = 88/155 (56.77%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            RH   +D     T +D   K G IV+A ++F +      E D+  ++ L+    +SG    A  LF+ +    +  +V+T+N++I +L  +G++D+A D+FL M++ G+ P+ +++ T+M G ++N  + + +  L +M E  + P+A ++++ +
Sbjct:  403 RHSFESDIVLASTVMDMYAKCGSIVDAKKVFDST----VEKDLILWNTLLAAYAESGLSGEALRLFYGMQLEGVPPNVITWNLIILSLLRNGQVDEAKDMFLQMQSSGIIPNLISWTTMMNGMVQNGCSEEAILFLRKMQESGLRPNAFSITVAL 553          
BLAST of FC928858 vs. ExPASy Swiss-Prot
Match: PPR9_ARATH (Pentatricopeptide repeat-containing protein At1g03560, mitochondrial OS=Arabidopsis thaliana GN=At1g03560 PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.509e-13
Identity = 45/170 (26.47%), Postives = 83/170 (48.82%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEISLNSIPQFK 525
            G+     A+   I GLCK G + E   +F  +     + ++  Y+ LIDG  KSG ++ A  L H +       DVVTY+++++ LC +G++++A D F      G+A + + +++L+ G  +     +   L   M E+    D+   + ++D   K+     +I  FK
Sbjct:  322 GIQVPPHAFSLVIGGLCKEGKLNEGYTVFENMIRKGSKPNVAIYTVLIDGYAKSGSVEDAIRLLHRMIDEGFKPDVVTYSVVVNGLCKNGRVEEALDYFHTCRFDGLAINSMFYSSLIDGLGKAGRVDEAERLFEEMSEKGCTRDSYCYNALIDAFTKHRKVDEAIALFK 491          

HSP 2 Score: 76.6406 bits (187), Expect = 1.970e-13
Identity = 47/148 (31.76%), Postives = 71/148 (47.97%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDM-EAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDAS 456
            G   D   Y   ++GLCKNG + EAL+ F T R     ++   YS LIDGL K+GR+  A  LF  +       D   YN +I A     K+D+A  LF  M E +G       +  L+ G  + +   + ++L   M ++ + P A+
Sbjct:  392 GFKPDVVTYSVVVNGLCKNGRVEEALDYFHTCRFDGLAINSMFYSSLIDGLGKAGRVDEAERLFEEMSEKGCTRDSYCYNALIDAFTKHRKVDEAIALFKRMEEEEGCDQTVYTYTILLSGMFKEHRNEEALKLWDMMIDKGITPTAA 539          

HSP 3 Score: 75.485 bits (184), Expect = 4.390e-13
Identity = 41/141 (29.08%), Postives = 74/141 (52.48%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDE 432
            R G   +   Y   IDG  K+G + +A+ L   +     + D+ +YS +++GLCK+GR++ A + FH+     L  + + Y+ +I  L   G++D+A  LF +M  KG   D   +N L+    ++ +  + + L  RM+E
Sbjct:  355 RKGSKPNVAIYTVLIDGYAKSGSVEDAIRLLHRMIDEGFKPDVVTYSVVVNGLCKNGRVEEALDYFHTCRFDGLAINSMFYSSLIDGLGKAGRVDEAERLFEEMSEKGCTRDSYCYNALIDAFTKHRKVDEAIALFKRMEE 495          

HSP 4 Score: 69.3218 bits (168), Expect = 3.146e-11
Identity = 42/151 (27.81%), Postives = 72/151 (47.68%), Query Frame = 1
Query:   37 AYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            A    I    K G + E L ++R ++    E  + +Y+ L++GL  +  +  A  +F  +  G +  D+VTYN MI   C  G+  KA +   DME +G   D + + T++  C  +++    V L   MDE+ +       S+V+  L K
Sbjct:  189 AANALIKSFGKLGMVEELLWVWRKMKENGIEPTLYTYNFLMNGLVSAMFVDSAERVFEVMESGRIKPDIVTYNTMIKGYCKAGQTQKAMEKLRDMETRGHEADKITYMTMIQACYADSDFGSCVALYQEMDEKGIQVPPHAFSLVIGGLCK 339          
BLAST of FC928858 vs. ExPASy Swiss-Prot
Match: PPR77_ARATH (Pentatricopeptide repeat-containing protein At1g52620 OS=Arabidopsis thaliana GN=At1g52620 PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.509e-13
Identity = 43/161 (26.71%), Postives = 77/161 (47.83%), Query Frame = 1
Query:    7 RRHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            +  G+    W     ID   ++GY V+  E    +    C+ D+ +Y+ LI+ LCK G+ ++A        +  LI + ++Y  +I A C   + D A  L L M  +G  PD V +  L+ G + +      V +  ++ +R V PDA+  ++++  L K
Sbjct:  302 KERGLRVSVWFLNNIIDAKYRHGYKVDPAESIGWIIANDCKPDVATYNILINRLCKEGKKEVAVGFLDEASKKGLIPNNLSYAPLIQAYCKSKEYDIASKLLLQMAERGCKPDIVTYGILIHGLVVSGHMDDAVNMKVKLIDRGVSPDAAIYNMLMSGLCK 462          

HSP 2 Score: 75.485 bits (184), Expect = 4.390e-13
Identity = 57/221 (25.79%), Postives = 91/221 (41.18%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEISLNSIPQFKSQRXXXXXXXXXXXXXA*KPDLEDPILINTCKGVLSNVGMFLGSVHGFCLQ 678
            G   D   Y   I GL  +G++ +A+ +   L       D   Y+ L+ GLCK+GR   A  LF  +    ++ D   Y  +I      G  D+A  +F     KGV  D V  N ++ G  R+    + +  ++RM+E +++PD  T S ++D  VK +    +I  F+                            N CK    NV  +   ++GFC Q
Sbjct:  410 GCKPDIVTYGILIHGLVVSGHMDDAVNMKVKLIDRGVSPDAAIYNMLMSGLCKTGRFLPAKLLFSEMLDRNILPDAYVYATLIDGFIRSGDFDEARKVFSLSVEKGVKVDVVHHNAMIKGFCRSGMLDEALACMNRMNEEHLVPDKFTYSTIIDGYVKQQDMATAIKIFRYMEK------------------------NKCK---PNVVTYTSLINGFCCQ 603          
BLAST of FC928858 vs. ExPASy Swiss-Prot
Match: PP187_ARATH (Pentatricopeptide repeat-containing protein At2g36240 OS=Arabidopsis thaliana GN=At2g36240 PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.509e-13
Identity = 46/151 (30.46%), Postives = 82/151 (54.30%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTL-RILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            +R+ ID  C+   +  AL  F T+ R++  + ++  Y+ +++G  KSG +  A   +  + +     DV T+NI+I+  C   K D A DLF +M+ KG  P+ V+FNTL+ G + + +  + V++ + M E       +T  I+VD L +
Sbjct:  160 FRSAIDAYCRARKMDYALLAFDTMKRLIDGKPNVGVYNTVVNGYVKSGDMDKALRFYQRMGKERAKPDVCTFNILINGYCRSSKFDLALDLFREMKEKGCEPNVVSFNTLIRGFLSSGKIEEGVKMAYEMIELGCRFSEATCEILVDGLCR 310          

HSP 2 Score: 67.781 bits (164), Expect = 9.153e-11
Identity = 39/168 (23.21%), Postives = 79/168 (47.02%), Query Frame = 1
Query:    7 RRHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEISLNS 510
            +  G   +  ++ T I G   +G I E +++   +  L C     +   L+DGLC+ GR+  A  L   L    ++     Y  ++  LC + K  +A ++  ++  KG  P  +A  TL+ G  ++  T K    + +M    ++PD+ T ++++  L  ++ S ++
Sbjct:  255 KEKGCEPNVVSFNTLIRGFLSSGKIEEGVKMAYEMIELGCRFSEATCEILVDGLCREGRVDDACGLVLDLLNKRVLPSEFDYGSLVEKLCGENKAVRAMEMMEELWKKGQTPCFIACTTLVEGLRKSGRTEKASGFMEKMMNAGILPDSVTFNLLLRDLCSSDHSTDA 422          
BLAST of FC928858 vs. ExPASy Swiss-Prot
Match: PP156_ARATH (Pentatricopeptide repeat-containing protein At2g16880 OS=Arabidopsis thaliana GN=At2g16880 PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.509e-13
Identity = 46/138 (33.33%), Postives = 74/138 (53.62%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSC--LIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHR 423
            G+  D   + + I G CK G + +A E +     +K      +Y+C  L++GLCK G  + A   F++L     + D VTYN MI A C D K+ +A+DL  +ME KG+ PD   +N+ +   + + + S+  ELL +
Sbjct:  551 GLLPDDSTFNSIILGYCKEGRVEKAFEFYN--ESIKHSFKPDNYTCNILLNGLCKEGMTEKALNFFNTLIEEREV-DTVTYNTMISAFCKDKKLKEAYDLLSEMEEKGLEPDRFTYNSFISLLMEDGKLSETDELLKK 685          

HSP 2 Score: 74.3294 bits (181), Expect = 9.779e-13
Identity = 42/154 (27.27%), Postives = 77/154 (50.00%), Query Frame = 1
Query:   13 HGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            HG + D   Y T I    K G +  ALE+ R +     +++  + + ++D LCK  +L  A  L +S  +   I D VTY  +I     + K++KA +++ +M+   + P    FN+L+ G   + +T   +E    + E  ++PD ST + ++
Sbjct:  410 HGFSPDIVTYHTLIKAYLKVGDLSGALEMMREMGQKGIKMNTITLNTILDALCKERKLDEAHNLLNSAHKRGFIVDEVTYGTLIMGFFREEKVEKALEMWDEMKKVKITPTVSTFNSLIGGLCHHGKTELAMEKFDELAESGLLPDDSTFNSII 563          

HSP 3 Score: 73.1738 bits (178), Expect = 2.179e-12
Identity = 45/159 (28.30%), Postives = 81/159 (50.94%), Query Frame = 1
Query:   19 VAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNE 495
            V  D   Y T +  + K G + +  EL   ++      +  +Y+ L+ G CK G LK A+++   + +  ++ D+ TYNI+I+ LC  G M +  +L   M++  + PD V +NTL+ GC     + +  +L+ +M+   V  +  T +I +  L K E
Sbjct:  236 VNPDNVTYNTILKAMSKKGRLSDLKELLLDMKKNGLVPNRVTYNNLVYGYCKLGSLKEAFQIVELMKQTNVLPDLCTYNILINGLCNAGSMREGLELMDAMKSLKLQPDVVTYNTLIDGCFELGLSLEARKLMEQMENDGVKANQVTHNISLKWLCKEE 394          

HSP 4 Score: 70.8626 bits (172), Expect = 1.081e-11
Identity = 42/163 (25.77%), Postives = 79/163 (48.47%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRM-DERNVIPDASTLSIVVDLLVKNE 495
            + G   D   Y T I G  +   + +ALE++  ++ +K    + +++ LI GLC  G+ ++A E F  L    L+ D  T+N +I   C +G+++KA + + +       PD    N L+ G  +   T K +   + + +ER V  D  T + ++    K++
Sbjct:  479 KRGFIVDEVTYGTLIMGFFREEKVEKALEMWDEMKKVKITPTVSTFNSLIGGLCHHGKTELAMEKFDELAESGLLPDDSTFNSIILGYCKEGRVEKAFEFYNESIKHSFKPDNYTCNILLNGLCKEGMTEKALNFFNTLIEEREV--DTVTYNTMISAFCKDK 639          

HSP 5 Score: 70.0922 bits (170), Expect = 1.844e-11
Identity = 43/171 (25.15%), Postives = 82/171 (47.95%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEISLNSIPQFKS 528
            G+  +T    T +D LCK   + EA  L  +       +D  +Y  LI G  +  +++ A E++  + +  +   V T+N +I  LC  GK + A + F ++   G+ PD   FN+++LG  +     K  E  +   + +  PD  T +I+++ L K  ++  ++  F +
Sbjct:  446 GIKMNTITLNTILDALCKERKLDEAHNLLNSAHKRGFIVDEVTYGTLIMGFFREEKVEKALEMWDEMKKVKITPTVSTFNSLIGGLCHHGKTELAMEKFDELAESGLLPDDSTFNSIILGYCKEGRVEKAFEFYNESIKHSFKPDNYTCNILLNGLCKEGMTEKALNFFNT 616          

HSP 6 Score: 70.0922 bits (170), Expect = 1.844e-11
Identity = 43/152 (28.29%), Postives = 81/152 (53.29%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDM-EAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            + + I GLC +G    A+E F  L       D  +++ +I G CK GR++ A+E ++   +     D  T NI+++ LC +G  +KA + F  + E + V  D V +NT++    ++ +  +  +LL  M+E+ + PD  T +  + LL+++
Sbjct:  524 FNSLIGGLCHHGKTELAMEKFDELAESGLLPDDSTFNSIILGYCKEGRVEKAFEFYNESIKHSFKPDNYTCNILLNGLCKEGMTEKALNFFNTLIEEREV--DTVTYNTMISAFCKDKKLKEAYDLLSEMEEKGLEPDRFTYNSFISLLMED 673          

HSP 7 Score: 69.3218 bits (168), Expect = 3.146e-11
Identity = 35/134 (26.12%), Postives = 73/134 (54.48%), Query Frame = 1
Query:   79 IVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLI-ADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            I  A E+F  +  +   L++++++ L++G C  G+L+ A  +   +     +  D VTYN ++ A+   G++    +L LDM+  G+ P+ V +N L+ G  +     +  +++  M + NV+PD  T +I+++
Sbjct:  185 ISSAREVFDDMVKIGVSLNVQTFNVLVNGYCLEGKLEDALGMLERMVSEFKVNPDNVTYNTILKAMSKKGRLSDLKELLLDMKKNGLVPNRVTYNNLVYGYCKLGSLKEAFQIVELMKQTNVLPDLCTYNILIN 318          
BLAST of FC928858 vs. ExPASy Swiss-Prot
Match: PP299_ARATH (Pentatricopeptide repeat-containing protein At4g01570 OS=Arabidopsis thaliana GN=At4g01570 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.970e-13
Identity = 48/175 (27.43%), Postives = 86/175 (49.14%), Query Frame = 1
Query:   13 HGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEISLNS--IPQFKSQ 531
            +G   DT  Y   +DG  K   + EA +LF  +          +Y+ LIDGL ++GR +  + LF  L +     D +T++I+   LC +GK++ A  L  +ME +G + D V  ++L++G  +        +L+  + E N++P+    +  V+  +K   S +    P F S+
Sbjct:  353 NGFVPDTIVYNCLLDGTLKARKVTEACQLFEKMVQEGVRASCWTYNILIDGLFRNGRAEAGFTLFCDLKKKGQFVDAITFSIVGLQLCREGKLEGAVKLVEEMETRGFSVDLVTISSLLIGFHKQGRWDWKEKLMKHIREGNLVPNVLRWNAGVEASLKRPQSKDKDYTPMFPSK 527          

HSP 2 Score: 73.559 bits (179), Expect = 1.668e-12
Identity = 43/150 (28.67%), Postives = 74/150 (49.33%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLS 465
            G   D   YR  I G CK+  + +A+ ++  ++      D   Y+CL+DG  K+ ++  A +LF  + +  + A   TYNI+I  L  +G+ +    LF D++ KG   D + F+ + L   R  +    V+L+  M+ R    D  T+S
Sbjct:  319 GHEPDNSTYRILIQGCCKSYRMDDAMRIYGEMQYNGFVPDTIVYNCLLDGTLKARKVTEACQLFEKMVQEGVRASCWTYNILIDGLFRNGRAEAGFTLFCDLKKKGQFVDAITFSIVGLQLCREGKLEGAVKLVEEMETRGFSVDLVTIS 468          

HSP 3 Score: 70.8626 bits (172), Expect = 1.081e-11
Identity = 46/161 (28.57%), Postives = 77/161 (47.83%), Query Frame = 1
Query:   28 DTWAYRTFIDGLCKNGYIVEALELFRTLRILKCEL------DIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            DTW+Y   I G    G +  AL LF+ ++            DI +Y+ LI  LC  G+ K A  ++  L       D  TY I+I   C   +MD A  ++ +M+  G  PD + +N L+ G ++  + ++  +L  +M +  V     T +I++D L +N
Sbjct:  247 DTWSYNICIHGFGCWGDLDAALSLFKEMKERSSVYGSSFGPDICTYNSLIHVLCLFGKAKDALIVWDELKVSGHEPDNSTYRILIQGCCKSYRMDDAMRIYGEMQYNGFVPDTIVYNCLLDGTLKARKVTEACQLFEKMVQEGVRASCWTYNILIDGLFRN 407          
BLAST of FC928858 vs. ExPASy Swiss-Prot
Match: PP298_ARATH (Pentatricopeptide repeat-containing protein At4g01400, mitochondrial OS=Arabidopsis thaliana GN=At4g01400 PE=2 SV=2)

HSP 1 Score: 76.6406 bits (187), Expect = 1.970e-13
Identity = 44/149 (29.53%), Postives = 73/149 (48.99%), Query Frame = 1
Query:    4 TRRHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPD 450
            +R HGV  +T +Y   +   C N  +  A +LF  +       D+ SY  LI G C+ G++  A EL   +     + D ++Y  ++++LC   ++ +A+ L   M+ KG  PD V +NT++LG  R +           MD R V+ D
Sbjct:  181 SRLHGVMPNTRSYNLLMQAFCLNDDLSIAYQLFGKMLERDVVPDVDSYKILIQGFCRKGQVNGAMELLDDMLNKGFVPDRLSYTTLLNSLCRKTQLREAYKLLCRMKLKGCNPDLVHYNTMILGFCREDRA---------MDARKVLDD 320          

HSP 2 Score: 75.8702 bits (185), Expect = 3.361e-13
Identity = 41/126 (32.54%), Postives = 69/126 (54.76%), Query Frame = 1
Query:   73 GYIVEALELFRTLRILKCELDIRSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPD 450
            GY+ +A ELF++ R+     + RSY+ L+   C +  L IA++LF  +    ++ DV +Y I+I   C  G+++ A +L  DM  KG  PD +++ TL+    R  +  +  +LL RM  +   PD
Sbjct:  169 GYLQKAFELFKSSRLHGVMPNTRSYNLLMQAFCLNDDLSIAYQLFGKMLERDVVPDVDSYKILIQGFCRKGQVNGAMELLDDMLNKGFVPDRLSYTTLLNSLCRKTQLREAYKLLCRMKLKGCNPD 294          
The following BLAST results are available for this feature:
BLAST of FC928858 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 137
Match NameE-valueIdentityDescription
PPR40_ARATH8.845e-1425.00Pentatricopeptide repeat-containing protein At1g13... [more]
PP447_ARATH8.845e-1428.48Putative pentatricopeptide repeat-containing prote... [more]
PP325_ARATH8.845e-1428.67Pentatricopeptide repeat-containing protein At4g19... [more]
PP431_ARATH1.155e-1327.10Pentatricopeptide repeat-containing protein At5g55... [more]
PPR9_ARATH1.509e-1326.47Pentatricopeptide repeat-containing protein At1g03... [more]
PPR77_ARATH1.509e-1326.71Pentatricopeptide repeat-containing protein At1g52... [more]
PP187_ARATH1.509e-1330.46Pentatricopeptide repeat-containing protein At2g36... [more]
PP156_ARATH1.509e-1333.33Pentatricopeptide repeat-containing protein At2g16... [more]
PP299_ARATH1.970e-1327.43Pentatricopeptide repeat-containing protein At4g01... [more]
PP298_ARATH1.970e-1329.53Pentatricopeptide repeat-containing protein At4g01... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH1CB01RM2 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH1CB01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC928858 ID=FC928858|Name=FC928858|organism=Citrus clementina|type=EST|length=866bp
GGCACGAGGCGTCATGGCGTGGCAGCTGATACCTGGGCATATAGAACCTT
TATTGATGGGCTCTGCAAGAATGGTTATATTGTAGAGGCACTTGAACTAT
TTCGTACTTTGAGAATTCTCAAGTGTGAACTTGATATTCGATCCTACAGC
TGCCTCATTGATGGATTATGTAAATCCGGCAGACTCAAAATTGCATGGGA
ACTATTTCATAGTTTGCCTCGTGGAGTCCTAATAGCAGATGTTGTAACAT
ATAACATCATGATCCATGCGCTTTGTGCTGATGGAAAAATGGACAAGGCA
CATGATTTGTTTCTTGATATGGAAGCAAAAGGTGTAGCACCCGATTGTGT
CGCATTTAACACGCTGATGCTAGGTTGCATCCGCAATAATGAGACATCAA
AAGTTGTTGAACTCCTTCACAGAATGGATGAGAGAAATGTGATACCAGAT
GCATCTACACTTTCAATTGTTGTGGACTTACTTGTAAAGAATGAAATTAG
CTTAAACTCCATTCCACAATTCAAGAGTCAAAGGTAAGTGAGTTTAATAT
TGATTTAGTCGCATGTTTCTTCTGCCTGAAAACCCGATCTGGAGGATCCC
ATTCTTATTAACACGTGTAAAGGAGTGTTGTCTAATGTTGGCATGTTCCT
AGGTTCTGTCCATGGATTCTGTTTGCAGACATGGCTAACTTCTTGTCCAA
CAGATAAGTTTTAAAGTCTTTCAACTTTATGTTGTAAAATAACATTTTCA
TTATTCAATTCATGAGTTTTCCTTCTGTATCACATACTTCTCATTAGCTG
GAAGCGCAAATTTTTTAGGCTTTTCCTGTATGGCCTCTTTTTCTGCTCTA
AATAAAATGGCATTTT
back to top