FC928906

Overview
NameFC928906
Unique NameFC928906
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length542
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15015 contig Ccv1_Contig15015:1..542. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC928906 vs. ExPASy Swiss-Prot
Match: SCP14_ARATH (Serine carboxypeptidase-like 14 OS=Arabidopsis thaliana GN=SCPL14 PE=2 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.072e-21
Identity = 52/115 (45.22%), Postives = 71/115 (61.74%), Query Frame = 1
Query:   22 DKSLSYTTNVLSSVDYHRNFIKKGYQVLIYSGDVDMGTSYVGTETWIKSLNLTIDSGWQPWLVDGQVAGFWMRYAEKNLYRLTFATVKGAGHTAPEYKPKECLEMINRWFAMYPL 366
            D S+    ++ SS+ YH N   KGY+ L+ SGD DM   ++GT+ WI+SLN +I   W+PW++  QVAG+   YA K    +T ATVKG GHT  EYKP+E   +  RW +  PL
Sbjct:  326 DLSVRSNQDIKSSIPYHMNNSIKGYRSLVISGDHDMTIPFLGTQAWIRSLNYSITEKWRPWMILDQVAGYTKTYANK----MTLATVKGGGHTL-EYKPEENSILFKRWISGQPL 435          
BLAST of FC928906 vs. ExPASy Swiss-Prot
Match: SCP19_ARATH (Serine carboxypeptidase-like 19 OS=Arabidopsis thaliana GN=SCPL19 PE=1 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 1.828e-21
Identity = 52/120 (43.33%), Postives = 72/120 (60.00%), Query Frame = 1
Query:   10 NRHEDKSLSYTTNVLSSVDYHRNFIKKGYQVLIYSGDVDMGTSYVGTETWIKSLNLTIDSGWQPWLV-DGQVAGFWMRYAEKNLYRLTFATVKGAGHTAPEYKPKECLEMINRWFAMYPL 366
            NR   +++ YT  + ++V YH N   KG++ LIYSGD D    +  T+ WI++LN +I   W+PW++   QVAG+   YA K    +TFAT+KG GHTA EY P +C  M  RW    PL
Sbjct:  351 NRCNSQNIPYTFEIFNAVPYHVNNSLKGFRSLIYSGDHDSMVPFSSTQAWIRALNYSIVDDWRPWMMSSNQVAGYTRTYANK----MTFATIKGGGHTA-EYTPDQCSLMFRRWIDGEPL 465          
BLAST of FC928906 vs. ExPASy Swiss-Prot
Match: SCP16_ARATH (Serine carboxypeptidase-like 16 OS=Arabidopsis thaliana GN=SCPL16 PE=2 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 2.387e-21
Identity = 51/109 (46.79%), Postives = 70/109 (64.22%), Query Frame = 1
Query:   28 SLSYTTNVLSSVDYHRNFIKKGYQVLIYSGDVDMGTSYVGTETWIKSLNLTIDSGWQPWLVDGQVAGFWMRYAEKNLYRLTFATVKGAGHTAPEYKPKECLEMINRWFA 354
            +L    ++ SS+ YH+    +GY+ LI+SGD DM T YVGT+ WI+SLN +I   W+PW++  QVAG+   YA K    +TFATVKG GHT  +YKP E   +  RW +
Sbjct:  328 TLQNNKDIKSSIPYHKKNSIQGYRSLIFSGDHDMLTPYVGTQDWIRSLNYSIIDKWRPWMILDQVAGYTTTYANK----MTFATVKGGGHTL-DYKPDENSILFKRWIS 431          
BLAST of FC928906 vs. ExPASy Swiss-Prot
Match: SCP15_ARATH (Serine carboxypeptidase-like 15 OS=Arabidopsis thaliana GN=SCPL15 PE=2 SV=2)

HSP 1 Score: 97.8265 bits (242), Expect = 3.447e-20
Identity = 48/107 (44.86%), Postives = 68/107 (63.55%), Query Frame = 1
Query:   46 NVLSSVDYHRNFIKKGYQVLIYSGDVDMGTSYVGTETWIKSLNLTIDSGWQPWLVDGQVAGFWMRYAEKNLYRLTFATVKGAGHTAPEYKPKECLEMINRWFAMYPL 366
            ++ SS+ +H N   +GY+ L+ SGD DM   ++GT+ WI+SLN +I   W+PW++  QVAG+   YA K    +T ATVKG GHT  EYKP+E   +  RW +  PL
Sbjct:  335 DIKSSIPFHINNSIRGYRSLVISGDHDMTIPFLGTQAWIRSLNYSITEKWRPWMILDQVAGYTKTYANK----MTLATVKGGGHTL-EYKPEENSVLFKRWISGQPL 436          
BLAST of FC928906 vs. ExPASy Swiss-Prot
Match: SCP38_ARATH (Serine carboxypeptidase-like 38 OS=Arabidopsis thaliana GN=SCPL38 PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 4.821e-14
Identity = 40/104 (38.46%), Postives = 60/104 (57.69%), Query Frame = 1
Query:   55 SSVDYHRNFIKKGYQVLIYSGDVDMGTSYVGTETWIKSLNLTIDSGWQPWLVDGQVAGFWMRYAEKNLYRLTFATVKGAGHTAPEYKPKECLEMINRWFAMYPL 366
            S V    + + +G +VL+YSGDVD    +  T   +K++NLT+ + W+PW   GQ+ GF   Y E+N   LT+ATVKG+GH+ P  +P   L +   +    PL
Sbjct:  384 SMVPILHDLMGEGVRVLVYSGDVDAAIPFTATMAVLKTMNLTVVNEWRPWFTGGQLGGFTEDY-ERN---LTYATVKGSGHSVPLDQPVHALNLFTSFIRNTPL 483          
BLAST of FC928906 vs. ExPASy Swiss-Prot
Match: SCP36_ARATH (Serine carboxypeptidase-like 36 OS=Arabidopsis thaliana GN=SCPL36 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 6.961e-13
Identity = 36/93 (38.71%), Postives = 51/93 (54.84%), Query Frame = 1
Query:   88 KGYQVLIYSGDVDMGTSYVGTETWIKSLNLTIDSGWQPWLVDGQVAGFWMRYAEKNLYRLTFATVKGAGHTAPEYKPKECLEMINRWFAMYPL 366
            KG +V++Y+GDVD+   +  T   +K++NLT+   W+PW   G V GF   Y       LTF TVKGAGH+ P  +P   L +   +    PL
Sbjct:  390 KGVRVMLYNGDVDLVIPFTSTLAVVKTMNLTVVKEWRPWFTGGHVGGFTEDYKG----NLTFVTVKGAGHSVPTDQPIHALNIFTSFIRNTPL 478          
BLAST of FC928906 vs. ExPASy Swiss-Prot
Match: PPGB_MOUSE (Lysosomal protective protein OS=Mus musculus GN=Ctsa PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 6.961e-13
Identity = 39/95 (41.05%), Postives = 55/95 (57.89%), Query Frame = 1
Query:   94 YQVLIYSGDVDMGTSYVGTETWIKSLNLTIDSGWQPWLVD-----GQVAGFWMRYAEKNLYRLTFATVKGAGHTAPEYKPKECLEMINRWFAMYP 363
            YQ+L+Y+GDVDM  +++G E ++ SLN  ++   +PWLVD      QVAGF      K    +TF T+KGAGH  P  KP+    M +R+    P
Sbjct:  384 YQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVDYGESGEQVAGF-----VKECSHITFLTIKGAGHMVPTDKPRAAFTMFSRFLNKEP 473          
BLAST of FC928906 vs. ExPASy Swiss-Prot
Match: SCP40_ARATH (Serine carboxypeptidase-like 40 OS=Arabidopsis thaliana GN=SCPL40 PE=2 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 1.551e-12
Identity = 35/98 (35.71%), Postives = 54/98 (55.10%), Query Frame = 1
Query:   73 RNFIKKGYQVLIYSGDVDMGTSYVGTETWIKSLNLTIDSGWQPWLVDGQVAGFWMRYAEKNLYRLTFATVKGAGHTAPEYKPKECLEMINRWFAMYPL 366
            +  + +G +V ++SGD D       T+  +K +NLT  + W PW + G+V G    Y E+   +LTFATV+GAGH  P ++PK  L +   +    PL
Sbjct:  403 KELMGQGVRVWVFSGDTDGRIPVTSTKYSLKKMNLTAKTAWHPWYLGGEVGG----YTEEYKGKLTFATVRGAGHQVPSFQPKRSLSLFIHFLNDTPL 496          
BLAST of FC928906 vs. ExPASy Swiss-Prot
Match: SCP30_ARATH (Putative serine carboxypeptidase-like 30 OS=Arabidopsis thaliana GN=SCPL30 PE=2 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 1.551e-12
Identity = 39/111 (35.14%), Postives = 59/111 (53.15%), Query Frame = 1
Query:   34 SYTTNVLSSVDYHRNFIKKGYQVLIYSGDVDMGTSYVGTETWIKSLNLTIDSGWQPWLVDGQVAGFWMRYAEKNLYRLTFATVKGAGHTAPEYKPKECLEMINRWFAMYPL 366
            ++T  V S +  ++  I  G ++ +YSGD D     +GT   + +L L I + W+PW  + QV+G+   Y       LTFAT +GAGHT P +KP   L  I+ +    PL
Sbjct:  375 NWTYVVQSVLPIYQKLIAGGLRIWVYSGDTDGCIPVLGTRYSLNALGLPIKTAWRPWYHEKQVSGWVQEYD-----GLTFATFRGAGHTVPSFKPSSSLAFISAFVKGVPL 480          
BLAST of FC928906 vs. ExPASy Swiss-Prot
Match: SCP32_ARATH (Serine carboxypeptidase-like 32 OS=Arabidopsis thaliana GN=SCPL32 PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 2.025e-12
Identity = 37/110 (33.64%), Postives = 57/110 (51.82%), Query Frame = 1
Query:   34 SYTTNVLSSVDYHRNFIKKGYQVLIYSGDVDMGTSYVGTETWIKSLNLTIDSGWQPWLVDGQVAGFWMRYAEKNLYRLTFATVKGAGHTAPEYKPKECLEMINRWFAMYP 363
            ++T +  S +  ++  I  G++V +YSGD D     + T   I  L L I + W+PW  + QV+G++  Y       LTFAT +GAGH  P +KP E L   + +    P
Sbjct:  354 NWTDSKRSVLPIYKKLIAGGFRVWVYSGDTDGRVPVLSTRYCINKLELPIKTAWRPWYHETQVSGWFQEYE-----GLTFATFRGAGHDVPSFKPSESLAFFSAFLNGVP 458          
The following BLAST results are available for this feature:
BLAST of FC928906 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 34
Match NameE-valueIdentityDescription
SCP14_ARATH1.072e-2145.22Serine carboxypeptidase-like 14 OS=Arabidopsis tha... [more]
SCP19_ARATH1.828e-2143.33Serine carboxypeptidase-like 19 OS=Arabidopsis tha... [more]
SCP16_ARATH2.387e-2146.79Serine carboxypeptidase-like 16 OS=Arabidopsis tha... [more]
SCP15_ARATH3.447e-2044.86Serine carboxypeptidase-like 15 OS=Arabidopsis tha... [more]
SCP38_ARATH4.821e-1438.46Serine carboxypeptidase-like 38 OS=Arabidopsis tha... [more]
SCP36_ARATH6.961e-1338.71Serine carboxypeptidase-like 36 OS=Arabidopsis tha... [more]
PPGB_MOUSE6.961e-1341.05Lysosomal protective protein OS=Mus musculus GN=Ct... [more]
SCP40_ARATH1.551e-1235.71Serine carboxypeptidase-like 40 OS=Arabidopsis tha... [more]
SCP30_ARATH1.551e-1235.14Putative serine carboxypeptidase-like 30 OS=Arabid... [more]
SCP32_ARATH2.025e-1233.64Serine carboxypeptidase-like 32 OS=Arabidopsis tha... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH1CE04RM2 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH1CE04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC928906 ID=FC928906|Name=FC928906|organism=Citrus clementina|type=EST|length=542bp
CTCGTGCCGAATCGGCACGAGGATAAAAGTTTATCTTACACAACAAATGT
CCTGAGTAGTGTTGATTATCATCGCAACTTCATCAAGAAGGGCTACCAAG
TTTTGATTTACAGTGGCGATGTGGACATGGGAACTTCATATGTAGGCACA
GAAACATGGATTAAGTCATTAAATTTGACGATTGATAGTGGCTGGCAGCC
GTGGCTTGTGGACGGCCAAGTTGCAGGATTTTGGATGCGGTATGCTGAAA
AGAACCTTTACCGTTTGACATTTGCCACAGTAAAGGGAGCAGGTCATACG
GCTCCAGAGTACAAGCCTAAGGAATGCCTCGAAATGATTAACAGGTGGTT
TGCCATGTATCCTCTTTGAAGCCATGTTCAGTACTTTGAGAATGGAAATG
TATTGGATTATGTTGTATTGCATTAACATTATATTACAATAATGTTGTAC
GGTGTTTAGCGCTGCACTGTACTGTATTAATTTCATATAATATTACATTA
ATGTTATTTAAATGTATTAGTAGATAAAAAAAAAAAAAAAAA
back to top