FC928931

Overview
NameFC928931
Unique NameFC928931
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length678
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig386 contig Ccv1_Contig386:23..700. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC928931 vs. ExPASy Swiss-Prot
Match: CYB51_SCHPO (Probable cytochrome b5 1 OS=Schizosaccharomyces pombe GN=SPBC29A10.16c PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.256e-16
Identity = 35/79 (44.30%), Postives = 55/79 (69.62%), Query Frame = 2
Query:   95 KVYTLAEVSGHNDRKDCWLIIEGKVYDVTKFLDDHPGGDEVLLSATGKDATDDFEDVGHSSSAKAMMDEFYVGDIDSST 331
            K +   E+  HN+ KD +++I GKVYDV+ F DDHPGG +++L   G+DAT  ++D+GHS +A  +++E Y+GD+   T
Sbjct:    4 KYFEPEEIVEHNNSKDMYMVINGKVYDVSNFADDHPGGLDIMLDYAGQDATKAYQDIGHSIAADELLEEMYIGDLKPGT 82          
BLAST of FC928931 vs. ExPASy Swiss-Prot
Match: NIA2_ARATH (Nitrate reductase [NADH] 2 OS=Arabidopsis thaliana GN=NIA2 PE=1 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 3.093e-15
Identity = 33/80 (41.25%), Postives = 53/80 (66.25%), Query Frame = 2
Query:   80 MGGEGKVYTLAEVSGHNDRKDCWLIIEGKVYDVTKFLDDHPGGDEVLLSATGKDATDDFEDVGHSSSAKAMMDEFYVGDI 319
            M    K+Y+++EV  HN    CW+I+ G +YD T+FL DHPGG + +L   G D T++FE + HS  AK M++++ +G++
Sbjct:  538 MNTTAKMYSMSEVKKHNSADSCWIIVHGHIYDCTRFLMDHPGGSDSILINAGTDCTEEFEAI-HSDKAKKMLEDYRIGEL 616          
BLAST of FC928931 vs. ExPASy Swiss-Prot
Match: NIA1_PHAVU (Nitrate reductase [NADH] 1 OS=Phaseolus vulgaris GN=NIA1 PE=3 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 4.039e-15
Identity = 34/75 (45.33%), Postives = 53/75 (70.67%), Query Frame = 2
Query:   95 KVYTLAEVSGHNDRKDCWLIIEGKVYDVTKFLDDHPGGDEVLLSATGKDATDDFEDVGHSSSAKAMMDEFYVGDI 319
            K Y+L+EV  HN+R   W+I+ G VYD T+FL DHPGG++ +L   G D T++FE + HS  AK M++++ +G++
Sbjct:  516 KSYSLSEVRRHNNRDSAWIIVNGHVYDCTRFLKDHPGGEDSILLNAGTDCTEEFEAI-HSDKAKKMLEDYRIGEL 589          
BLAST of FC928931 vs. ExPASy Swiss-Prot
Match: NIA1_MAIZE (Nitrate reductase [NADH] (Fragment) OS=Zea mays PE=1 SV=2)

HSP 1 Score: 81.6481 bits (200), Expect = 4.039e-15
Identity = 34/84 (40.48%), Postives = 55/84 (65.48%), Query Frame = 2
Query:   68 PFLQMGGEGKVYTLAEVSGHNDRKDCWLIIEGKVYDVTKFLDDHPGGDEVLLSATGKDATDDFEDVGHSSSAKAMMDEFYVGDI 319
            PF+     GK +T++EV  H  ++  W+++ G VYD TKFL DHPGG + +L   G D T++F+ + HS  AKA++D + +G++
Sbjct:  241 PFMNTTDVGKEFTMSEVRKHASQESAWIVVHGHVYDCTKFLKDHPGGADSILINAGTDCTEEFDAI-HSDKAKALLDTYRIGEL 323          
BLAST of FC928931 vs. ExPASy Swiss-Prot
Match: NIA2_SOYBN (Inducible nitrate reductase [NADH] 2 OS=Glycine max GN=INR2 PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 6.890e-15
Identity = 34/83 (40.96%), Postives = 54/83 (65.06%), Query Frame = 2
Query:   80 MGGEGKVYTLAEVSGHNDRKDCWLIIEGKVYDVTKFLDDHPGGDEVLLSATGKDATDDFEDVGHSSSAKAMMDEFYVGDIDSS 328
            M    K YT++EV  HN+    W+I+ G VYD T+FL DHPGG + +L   G D T++FE + HS  AK M++++ +G++ ++
Sbjct:  513 MNTTSKTYTMSEVRRHNNADSAWIIVHGHVYDCTRFLKDHPGGTDSILINAGTDCTEEFEAI-HSDKAKQMLEDYRIGELTTT 594          
BLAST of FC928931 vs. ExPASy Swiss-Prot
Match: NIA1_SOYBN (Inducible nitrate reductase [NADH] 1 OS=Glycine max GN=INR1 PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.535e-14
Identity = 34/83 (40.96%), Postives = 54/83 (65.06%), Query Frame = 2
Query:   80 MGGEGKVYTLAEVSGHNDRKDCWLIIEGKVYDVTKFLDDHPGGDEVLLSATGKDATDDFEDVGHSSSAKAMMDEFYVGDIDSS 328
            M    K YT++EV  HN+    W+I+ G VYD T+FL DHPGG + +L   G D T++FE + HS  AK M++++ +G++ ++
Sbjct:  509 MNTTSKTYTMSEVRRHNNADSAWIIVHGHVYDWTRFLKDHPGGTDRILINAGTDCTEEFEAI-HSDKAKQMLEDYRIGELTTT 590          
BLAST of FC928931 vs. ExPASy Swiss-Prot
Match: NIA_LOTJA (Nitrate reductase [NADH] OS=Lotus japonicus GN=NIA PE=3 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.618e-14
Identity = 34/75 (45.33%), Postives = 51/75 (68.00%), Query Frame = 2
Query:   95 KVYTLAEVSGHNDRKDCWLIIEGKVYDVTKFLDDHPGGDEVLLSATGKDATDDFEDVGHSSSAKAMMDEFYVGDI 319
            K+Y+L+EV  HN     W+I+ G VYD T+FL DHPGG + +L   G D T++FE + HS  AK M++++ VG++
Sbjct:  522 KMYSLSEVKKHNSPDSAWIIVHGHVYDCTRFLKDHPGGADSILINAGTDCTEEFEAI-HSDKAKKMLEDYRVGEL 595          
BLAST of FC928931 vs. ExPASy Swiss-Prot
Match: NIA_CUCMA (Nitrate reductase [NADH] OS=Cucurbita maxima PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.618e-14
Identity = 33/80 (41.25%), Postives = 51/80 (63.75%), Query Frame = 2
Query:   80 MGGEGKVYTLAEVSGHNDRKDCWLIIEGKVYDVTKFLDDHPGGDEVLLSATGKDATDDFEDVGHSSSAKAMMDEFYVGDI 319
            M      YTL+EV  HN  +  W+I+ G VYD T+FL DHPGG + +L   G D T++F+ + HS  AK M++++ +G++
Sbjct:  539 MNTASNTYTLSEVKKHNSPQSAWIIVHGHVYDCTRFLKDHPGGSDSILINAGTDCTEEFDAI-HSDKAKKMLEDYRIGEL 617          
BLAST of FC928931 vs. ExPASy Swiss-Prot
Match: NIA2_HORVU (Nitrate reductase [NADH] (Fragment) OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.618e-14
Identity = 33/84 (39.29%), Postives = 55/84 (65.48%), Query Frame = 2
Query:   68 PFLQMGGEGKVYTLAEVSGHNDRKDCWLIIEGKVYDVTKFLDDHPGGDEVLLSATGKDATDDFEDVGHSSSAKAMMDEFYVGDI 319
            PF+   G+ K +T++EV  H  ++  W+++ G VYD T FL DHPGG + +L   G D T++F+ + HS  AKA++D + +G++
Sbjct:  528 PFMNTAGD-KQFTMSEVRKHGSKESAWIVVHGHVYDCTAFLKDHPGGADSILINAGSDCTEEFDAI-HSDKAKALLDTYRIGEL 609          
BLAST of FC928931 vs. ExPASy Swiss-Prot
Match: NIA1_HORVU (Nitrate reductase [NADH] OS=Hordeum vulgare PE=3 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.618e-14
Identity = 33/84 (39.29%), Postives = 55/84 (65.48%), Query Frame = 2
Query:   68 PFLQMGGEGKVYTLAEVSGHNDRKDCWLIIEGKVYDVTKFLDDHPGGDEVLLSATGKDATDDFEDVGHSSSAKAMMDEFYVGDI 319
            PF+   G+ K +T++EV  H  ++  W+++ G VYD T FL DHPGG + +L   G D T++F+ + HS  AKA++D + +G++
Sbjct:  531 PFMNTAGD-KQFTMSEVRKHGSKESAWIVVHGHVYDCTAFLKDHPGGADSILINAGSDCTEEFDAI-HSDKAKALLDTYRIGEL 612          
The following BLAST results are available for this feature:
BLAST of FC928931 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 66
Match NameE-valueIdentityDescription
CYB51_SCHPO1.256e-1644.30Probable cytochrome b5 1 OS=Schizosaccharomyces po... [more]
NIA2_ARATH3.093e-1541.25Nitrate reductase [NADH] 2 OS=Arabidopsis thaliana... [more]
NIA1_PHAVU4.039e-1545.33Nitrate reductase [NADH] 1 OS=Phaseolus vulgaris G... [more]
NIA1_MAIZE4.039e-1540.48Nitrate reductase [NADH] (Fragment) OS=Zea mays PE... [more]
NIA2_SOYBN6.890e-1540.96Inducible nitrate reductase [NADH] 2 OS=Glycine ma... [more]
NIA1_SOYBN1.535e-1440.96Inducible nitrate reductase [NADH] 1 OS=Glycine ma... [more]
NIA_LOTJA2.618e-1445.33Nitrate reductase [NADH] OS=Lotus japonicus GN=NIA... [more]
NIA_CUCMA2.618e-1441.25Nitrate reductase [NADH] OS=Cucurbita maxima PE=2 ... [more]
NIA2_HORVU2.618e-1439.29Nitrate reductase [NADH] (Fragment) OS=Hordeum vul... [more]
NIA1_HORVU2.618e-1439.29Nitrate reductase [NADH] OS=Hordeum vulgare PE=3 S... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH1CF08RM2 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH1CF08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC928931 ID=FC928931; Name=FC928931; organism=Citrus clementina; type=EST; length=678bp
AAATCCGCTCCTCCTGGTGCTCACCTACTGGGCATAAAAGTTTCACGTTT
TTCCCTGAAAAATCTGACCTTTTTTACAAATGGGCGGAGAGGGCAAGGTA
TACACTTTGGCTGAGGTCTCTGGGCACAACGACCGCAAGGACTGTTGGCT
TATCATTGAGGGCAAGGTATATGATGTGACAAAATTCTTGGATGACCATC
CTGGTGGAGACGAGGTATTGTTGTCTGCCACAGGAAAGGATGCGACTGAT
GACTTTGAGGATGTTGGTCACAGTAGCAGTGCAAAAGCGATGATGGATGA
ATTCTATGTGGGTGACATTGATTCATCAACCGTTCCCACCAAGACCAAGT
ACACCCCTCCCAAGCAGCCTCACTACAACCAAGACAAGACACCCGAGTTT
ATTATAAAGCTCCTCCAGTTCCTAGTTCCTCTGCTAATCTTAGGATTGGC
TGTTGGCATCCGCTTCTATACCAAATCCGCTTAATGATACCTTGCAAGAT
AAAAATACATTTACAATAAATCTATATCCGTTGCATTGCACCTTGTTTTT
ACTAGTTGTTTGGAACTATTATCACCAGAAAATGTAGGGTTCTTTATCTT
TTGTGATGGCATGTGCTTGTGTTTGATAAGTGACCATTCACTGCCCGCAT
GACTTGGAATGCAATGATCAATTTGCAG
back to top