FC929261

Overview
NameFC929261
Unique NameFC929261
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length823
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig12949 contig Ccv1_Contig12949:141..963. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: RMLA_NEIMB (Glucose-1-phosphate thymidylyltransferase OS=Neisseria meningitidis serogroup B GN=rmlA1 PE=3 SV=2)

HSP 1 Score: 67.781 bits (164), Expect = 8.497e-11
Identity = 62/228 (27.19%), Postives = 104/228 (45.61%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLL-NPAVLDRIELRPTS---IEKEVFPKIALE-GKLFAMVL-PGF-WMDIG 813
            MK +IL GG GTRL P+T  V K L+   +KPMI + +  L   G+ ++++    +       L    +  GI I  + +  P G A    +  + + +D      VL  ++     F + ++   A    A++   +V  P ++GVV   E+   V    EKP+    +    G+Y   N AV    +L+P++   +E     ++ LE G L   +L  GF W+D G
Sbjct:    1 MKGIILAGGSGTRLYPITRGVSKQLLPVYDKPMIYYPLSVLMLAGIRDILVITAPEDNASFKRLLGDGSDFGISISYAVQPSPDGLAQAFIIGEEFIGND--NVCLVLGDNIFYGQSFTQTLKQAAAQTHGATVFAYQVKNPERFGVVEFNENFRAV-SIEEKPQRPKSDWAVTGLYFYDNRAVEFAKQLKPSARGELEITDLNRMYLEDGSLSVQILGRGFAWLDTG 225          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLMU_PELTS (Bifunctional protein glmU OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=glmU PE=3 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 8.497e-11
Identity = 56/206 (27.18%), Postives = 101/206 (49.03%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVL-NSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEK----PKLFVGNKINAGIYLLNPA-VLDRIE-LRPTSIEKEVF 747
            + A+IL  G GTR++     +PK L     +PM+ + + A+ A G+ ++V+   Y  E +    +E E    + +    + E LGTA  L  A   L    G+   +  ++ +I     A++  FH+  G  A+++  + D+P+ YG V+  +  G V K VE+    P   +  +IN GIY    A + D ++ +RP + + E +
Sbjct:    3 LAAVILAAGRGTRMKS---KLPKVLHRVCGRPMLSYIVNAVAAAGIKKIVVVAGYGAEQVA---REVEGLAQVAL----QAEQLGTAHALLQAGPFLSGFAGKVLVLCGDTPLIEAGTLAKLAGFHRTAGAAATLLTAEPDDPAGYGRVI-RDGRGNVIKIVEEKDASPAEKLIREINTGIYCFEAAGLFDALKGIRPANAQGEYY 197          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLMU_CLOTE (Bifunctional protein glmU OS=Clostridium tetani GN=glmU PE=3 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 8.497e-11
Identity = 53/194 (27.32%), Postives = 101/194 (52.06%), Query Frame = 1
Query:  157 ALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIIC-SQETEPLGTAGPLALARDKLIDDTGE-PFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVE-----KPKLFVGNKINAGIYLLN-PAVLDRIE 714
            A++L  G G R++  T   PK L +   K M+ H I+AL+   + +V + +  +        KE + K   + +  S + + LGT   +  A++ L+   G    F  ++ +I+      ++E+H+ +G   +I+ + +D PS YG V+  E+ G+V+K +E     K +L +  +INAG+Y  N  A+L+ ++
Sbjct:    5 AILLAAGEGKRMKSAT---PKVLHKVCGKEMVNHVIDALREANIEDVNVIVGKKA-------KEVQLKTESRSVSFSFQEQQLGTGHAVKCAKEFLLGKEGNVAIFTGDAPLITSKTIKTLMEYHETNGFHGTILTSIIDNPSGYGRVL-RENNGEVDKIIEHKDCLKEELKI-KEINAGMYCFNIQALLEALD 186          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLGC_STRMU (Glucose-1-phosphate adenylyltransferase OS=Streptococcus mutans GN=glgC PE=3 SV=2)

HSP 1 Score: 67.781 bits (164), Expect = 8.497e-11
Identity = 66/244 (27.05%), Postives = 110/244 (45.08%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMIL-HQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQET--EPL----------GTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKV--DEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVL-------DRIELRPTSIEKEVFPKIALEG-KLFAMVLPGFWMDIG 813
            M ALIL GG GTRL  LT S+ KP V+F  +  I+   +      G+  V +   YQP + LN      +  G+  I S  T  +P           GT+  +    D +     E   +L+ D I +  + +M++ HK +    ++ V  V   E S++G++ T +S  ++ +F EKP+     K + GIY+ N   L       ++  +  +   K V P     G +++     G+W D+G
Sbjct:    5 MLALILAGGQGTRLGKLTQSIAKPAVQFGGRYRIIDFALSNCANSGINNVGIITQYQP-LALNSHIGNGSSWGLDGINSGATILQPYSATEGNRWFQGTSHAIYQNIDYIDSINPEYVLILSGDHIYKMDYDDMLQTHKDNMASLTVAVIDVPLKEASRFGIMNT-DSNDRIVEFEEKPEQPKSTKASMGIYIFNWDRLRTMLVDAEKNNIDMSDFGKNVIPAYLESGERVYTYNFNGYWKDVG 246          
The following BLAST results are available for this feature:
BLAST of FC929261 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 124
Match NameE-valueIdentityDescription
RMLA_NEIMB8.497e-1127.19Glucose-1-phosphate thymidylyltransferase OS=Neiss... [more]
GLMU_PELTS8.497e-1127.18Bifunctional protein glmU OS=Pelotomaculum thermop... [more]
GLMU_CLOTE8.497e-1127.32Bifunctional protein glmU OS=Clostridium tetani GN... [more]
GLGC_STRMU8.497e-1127.05Glucose-1-phosphate adenylyltransferase OS=Strepto... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH3DC11RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH3DC11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929261 ID=FC929261|Name=FC929261|organism=Citrus clementina|type=EST|length=823bp
GCAAAGCAAAAGCGAAGCGCGCGAAGCTCGCCTCATCCGTTGACTGAGCT
GTCGGTCCCGAGTCACGACTCGCGACTCTTGTTTTTGAACTCAGTTGTTT
GCCGTTCGGATCCGGTCTTAATTAAAGGATAAAGCAGGCTCCGTATCACA
ATGAAGGCACTTATTCTTGTTGGAGGGTTCGGAACACGGTTGAGGCCGTT
GACGCTTAGTGTCCCTAAGCCACTTGTTGAATTTGCTAACAAACCCATGA
TCCTGCATCAGATAGAGGCCCTTAAGGCAGTTGGAGTGACTGAAGTAGTT
TTGGCTATTAACTACCAGCCAGAGGTGATGTTGAACTTTTTGAAGGAATT
TGAAGCAAAGCTTGGGATCAAGATCATCTGCTCACAAGAGACTGAGCCAC
TGGGCACTGCTGGTCCTCTGGCTCTGGCTAGAGACAAATTGATTGACGAT
ACTGGTGAGCCATTTTTCGTCCTTAACAGTGATGTTATTAGTGAGTACCC
ATTTGCAGAAATGATTGAATTCCACAAAGCACATGGAGGAGAGGCCTCCA
TCATGGTAACCAAGGTGGATGAGCCATCAAAATATGGTGTGGTGGTTACG
GAAGAGTCTACTGGAAAAGTTGAGAAATTCGTTGAGAAACCTAAATTATT
TGTTGGTAACAAAATTAATGCTGGAATTTATCTTTTGAACCCTGCGGTTC
TTGATCGCATTGAGCTGAGGCCCACCTCCATTGAGAAAGAGGTCTTTCCA
AAAATTGCTTTAGAAGGAAAGCTCTTCGCGATGGTTCTTCCAGGTTTCTG
GATGGACATTGGACAGCCGAGGG
back to top