FC929261

Overview
NameFC929261
Unique NameFC929261
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length823
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig12949 contig Ccv1_Contig12949:141..963. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GMPAA_XENLA (Mannose-1-phosphate guanyltransferase alpha-A OS=Xenopus laevis GN=gmppa-A PE=2 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 7.144e-34
Identity = 89/248 (35.89%), Postives = 127/248 (51.21%), Query Frame = 1
Query:  151 MKALILVGG--FGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAV-GVTEVVLAINYQPEVMLN-FLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMV----TKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRI--------------------ELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDI 810
            +KA+IL+GG   GTR RPL+  VPKPL   A  PM+ H IEA   V  + E++L   YQP   LN FL + + +  + I   QE   LGT G +   RD+++    + FFV+N+DV SE+P   M++FHK HGG  S ++        +   YG +V    T +V  +VEKP  FV + IN GIYL +P++   I                     +    +E++VF  +A  GKL+     G W  I
Sbjct:    2 LKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMVQHHIEACSKVPNLKEILLIGFYQPNEALNSFLLKAQQEFKVAIRYLQEYSALGTGGGIYHFRDQILSGGPQAFFVMNADVCSEFPLVSMLDFHKQHGGSQSYVILGTTANRTQSLNYGCIVANRDTQEVLHYVEKPGTFVSDIINCGIYLFSPSIFQHIAEVFQQNQQELQLEENSSWQRMEVIRLEQDVFSTLAGRGKLYVYKTEGCWSQI 249          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GMPAB_XENLA (Mannose-1-phosphate guanyltransferase alpha-B OS=Xenopus laevis GN=gmppa-B PE=2 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 6.047e-33
Identity = 90/253 (35.57%), Postives = 134/253 (52.96%), Query Frame = 1
Query:  151 MKALILVGG--FGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAV-GVTEVVLAINYQP-EVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMV----TKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVL---------DRIELRPTS----------------IEKEVFPKIALEGKLFAMVLPGFWMDI 810
            +KA+IL+GG   GTR RPL+  VPKPL   A  PM+ H IEA   V  + E++L   YQP E + +FL + + +  + I   QE   LGT G +   RD+++    + FFV+N+DV SE+P   M++FHK HGG  S ++        +   YG +V+   T +V  +VEKP  FV + IN GIYL +P++          +++EL+  S                +E++VF  +A  GKL+     G W  I
Sbjct:    2 LKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMVQHHIEACSKVPNLKEILLIGFYQPNEALSSFLLKAQQEFKVAIRYLQEYSALGTGGGIYHFRDQILSGGPQAFFVMNADVCSEFPLVPMLDFHKQHGGSQSYVILGTTANRTQSLNYGCIVSNGDTQEVLHYVEKPGTFVSDIINCGIYLFSPSIFQHIAEVFQRNQLELQLFSCISEENSSWQRTEVIRLEQDVFTTLAGHGKLYVYKTEGCWSQI 254          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GMPPA_XENTR (Mannose-1-phosphate guanyltransferase alpha OS=Xenopus tropicalis GN=gmppa PE=2 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 7.898e-33
Identity = 89/248 (35.89%), Postives = 129/248 (52.02%), Query Frame = 1
Query:  151 MKALILVGG--FGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAV-GVTEVVLAINYQP-EVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMV----TKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRI-----------ELRPTS---------IEKEVFPKIALEGKLFAMVLPGFWMDI 810
            +KA+IL+GG   GTR RPL+  VPKPL   A  PM+ H IEA   V  + E++L   YQP E + +FL + + +  + I   QE   LGT G +   RD+++    + FFV+N+DV S +P   M++FHK HGG  S ++        +   YG +V    T +V  +VEKP  FV + IN GIYL +P++   I           +L   S         +E++VF  +A  GKL+     G W  I
Sbjct:    2 LKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMVQHHIEACSKVPNLKEILLIGFYQPNEALSSFLLKAQQEFKVAIRYLQEYSALGTGGGIYHFRDQILSGGPQAFFVMNADVCSAFPLVPMLDFHKQHGGSQSYVILGTTANRSQSLNYGCIVANGETQEVLHYVEKPGTFVSDIINCGIYLFSPSIFQHIAEVFQRNQQELQLEENSSWQRTEVIRLEQDVFTTLAGRGKLYVYKTEGCWSQI 249          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GMPPA_DICDI (Mannose-1-phosphate guanyltransferase alpha OS=Dictyostelium discoideum GN=gmppA PE=2 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 2.298e-32
Identity = 86/252 (34.13%), Postives = 129/252 (51.19%), Query Frame = 1
Query:  148 TMKALILVGG--FGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAV-GVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDE--PSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRI--------------------------ELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDI 810
            T KA+ILVGG   GTR RPL+L VPK L   A KPMI H IEA   V  + E++L   +Q  V+  F+ E   +L + I    E + LGTAG L   RD +++      FVL+SD+   +P  ++++FHK HG   +IM T+++    ++YG +V +E T ++  + EKP+ FV N IN G+Y  +P   D I                          ++    +E+++F  +A  G +      GFW  I
Sbjct:    5 TTKAIILVGGPSKGTRFRPLSLDVPKLLFPIAGKPMIYHHIEACSKVENMKEIILIGFFQESVLSKFISETSKQLNVAIRYINEEKVLGTAGGLYHFRDIILEGGPSEIFVLHSDICCAFPLNDLLQFHKQHGRSCTIMGTEIESAYANQYGCLVRDEKTAELLHYAEKPETFVSNLINCGVYCFSPQFFDVIGKTMIDLKTSGQNITTDYPEITRKGFDVERLRLEQDIFVPLAGTGFISVYPYVGFWRQI 256          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GMPPA_MOUSE (Mannose-1-phosphate guanyltransferase alpha OS=Mus musculus GN=Gmppa PE=2 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 8.732e-32
Identity = 88/247 (35.63%), Postives = 131/247 (53.04%), Query Frame = 1
Query:  151 MKALILVGG--FGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAV-GVTEVVLAINYQP-EVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVD--EPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVL-------------DRIELRPTS--------IEKEVFPKIALEGKLFAMVLPGFWMDI 810
            +KA+IL+GG   GTR RPL+  VPKPL   A  PMI H IEA   V G+ E++L   YQP E +  FL+  + +  + +   QE  PLGT G L   RD+++    E FFVLN+DV S++P + M+E H+       ++ T  +  +   YG +V    T +V  +VEKP  F+ + IN GIYL +P  L              ++E  P S        +E++VF  +A +G+++  +  G W  I
Sbjct:    2 LKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVPGMQEILLIGFYQPDEALTQFLEAAQQEFNLPVRYLQEFAPLGTGGGLYHFRDQILAGAPEAFFVLNADVCSDFPLSAMLEAHRRQRHPFLLLGTTANRTQSLNYGCIVENPQTHEVLHYVEKPSTFISDIINCGIYLFSPEALKPLRDVFQRNQQDGQLEESPGSWPGAGTIRLEQDVFSALAGQGQIYVHLTDGIWSQI 248          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GMPAA_DANRE (Mannose-1-phosphate guanyltransferase alpha-A OS=Danio rerio GN=gmppaa PE=2 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 8.732e-32
Identity = 90/249 (36.14%), Postives = 123/249 (49.40%), Query Frame = 1
Query:  151 MKALILVGG--FGTRLRPLTLSVPKPLVEFANKPMILHQIEAL-KAVGVTEVVLAINYQPEVMLN-FLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSK----YGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRI---------------------ELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDI 810
            +KA+IL+GG   GTR RPL+  VPKPL   A  PM+ H IEA  K   + E++L   YQP   LN FL   +    I I   QE   LGT G +   RD+++    + FFV+N+DV SE+P  EM++F K HG   S ++       K    YG +V  E T +V  +VEKP  FV + IN GIYL  P +   I                           +E+++F  +A +GKL+      FW  I
Sbjct:    2 LKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMLQHHIEACSKLPNMKEILLIGFYQPNEELNRFLSCAQQDFKISIRYLQEYAALGTGGGIYHFRDQILSGGPDAFFVMNADVCSEFPLPEMLDFQKEHGDTYSFVILGTTANRKQSLNYGCIVENEQTDEVLHYVEKPGTFVSDIINCGIYLFTPEIFQHIGSVFQKNQQEMLLEEQSNGWHRAEVIRLEQDIFTALAGQGKLYVYKTDRFWSQI 250          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GMPPA_RAT (Mannose-1-phosphate guanyltransferase alpha OS=Rattus norvegicus GN=Gmppa PE=2 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 1.945e-31
Identity = 87/247 (35.22%), Postives = 131/247 (53.04%), Query Frame = 1
Query:  151 MKALILVGG--FGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAV-GVTEVVLAINYQP-EVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVD--EPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVL-------------DRIELRPTS--------IEKEVFPKIALEGKLFAMVLPGFWMDI 810
            +KA+IL+GG   GTR RPL+  VPKPL   A  PMI H IEA   V G+ E++L   YQP E +  FL+  + +  + +   QE  PLGT G L   RD+++    E FFVLN+DV S++P + M++ H+       ++ T  +  +   YG +V    T +V  +VEKP  F+ + IN GIYL +P  L              ++E  P S        +E++VF  +A +G+++  +  G W  I
Sbjct:    2 LKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVPGMQEILLIGFYQPDEALTQFLEAAQQEFNLPVRYLQEFTPLGTGGGLYHFRDQILAGAPEAFFVLNADVCSDFPLSAMLDAHRLQRHPFLLLGTTANRTQSLNYGCIVENPQTHEVLHYVEKPSTFISDIINCGIYLFSPEALKPLRDVFQRNQQDGQLEESPGSWPGAGTIRLEQDVFSALAGQGQIYVHLTDGIWSQI 248          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GMPPA_PAPAN (Mannose-1-phosphate guanyltransferase alpha OS=Papio anubis GN=GMPPA PE=3 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 4.334e-31
Identity = 87/247 (35.22%), Postives = 131/247 (53.04%), Query Frame = 1
Query:  151 MKALILVGG--FGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAV-GVTEVVLAINYQP-EVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVD--EPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVL-------------DRIELRP--------TSIEKEVFPKIALEGKLFAMVLPGFWMDI 810
            +KA+IL+GG   GTR RPL+  VPKPL   A  PMI H IEA   V G+ E++L   YQP E +  FL+  + +  + +   QE  PLGT G L   RD+++  + E FFVLN+DV S++P + M+E H+       ++ T  +  +   YG +V    T +V  +VEKP  F+ + IN GIYL +P  L              ++E  P          +E++VF  +A +G+++  +  G W  I
Sbjct:    2 LKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVPGMQEILLIGFYQPDEPLTQFLEAAQQEFNLPVRYLQEFAPLGTGGGLYHFRDQILAGSPEAFFVLNADVCSDFPLSAMLEAHRRQRHPFLLLGTTANRTQSLNYGCIVENPQTHEVLHYVEKPSTFISDIINCGIYLFSPEALKPLRDVFQRNQQDGQLEDSPGLWPGAGTIRLEQDVFSALAGQGQIYVHLTDGIWSQI 248          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GMPPA_HUMAN (Mannose-1-phosphate guanyltransferase alpha OS=Homo sapiens GN=GMPPA PE=1 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 4.334e-31
Identity = 87/247 (35.22%), Postives = 131/247 (53.04%), Query Frame = 1
Query:  151 MKALILVGG--FGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAV-GVTEVVLAINYQP-EVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVD--EPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVL-------------DRIELRP--------TSIEKEVFPKIALEGKLFAMVLPGFWMDI 810
            +KA+IL+GG   GTR RPL+  VPKPL   A  PMI H IEA   V G+ E++L   YQP E +  FL+  + +  + +   QE  PLGT G L   RD+++  + E FFVLN+DV S++P + M+E H+       ++ T  +  +   YG +V    T +V  +VEKP  F+ + IN GIYL +P  L              ++E  P          +E++VF  +A +G+++  +  G W  I
Sbjct:    2 LKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVPGMQEILLIGFYQPDEPLTQFLEAAQQEFNLPVRYLQEFAPLGTGGGLYHFRDQILAGSPEAFFVLNADVCSDFPLSAMLEAHRRQRHPFLLLGTTANRTQSLNYGCIVENPQTHEVLHYVEKPSTFISDIINCGIYLFSPEALKPLRDVFQRNQQDGQLEDSPGLWPGAGTIRLEQDVFSALAGQGQIYVHLTDGIWSQI 248          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GMPAB_DANRE (Mannose-1-phosphate guanyltransferase alpha-B OS=Danio rerio GN=gmppab PE=2 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 1.067e-29
Identity = 89/249 (35.74%), Postives = 122/249 (49.00%), Query Frame = 1
Query:  151 MKALILVGG--FGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAV-GVTEVVLAINYQPEVMLN-FLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHG----GEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRI--------------EL-------RPTSIEKEVFPKIALEGKLFAMVLPGFWMDI 810
            +KA+IL+GG   GTR RPL+  VPKPL   A  PM+ H IEA   V  + E++L   YQP   LN F+   + +  I I   QE   LGT G +   RD+++      FF++N+DV SE+P  EM++FH+ HG    G          +   YG +V    T +V  FVEKP  FV + IN GIYL  P +   I              EL           +E+++F  +A + KLF      FW  I
Sbjct:    2 LKAIILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMLQHHIEACAQVPDMKEIMLIGFYQPNDELNRFIYSAQQEFKIPIRYLQEFAALGTGGGIYHFRDQILSGGPAAFFLMNADVCSEFPLLEMLQFHRQHGENHCGVLLGTTANRTQSLNYGCIVENHETNEVLHFVEKPSTFVSDIINCGIYLFTPDIFAHIGKVFQRNQQEKIQEELTHGRQMPEVVRLEQDIFTALAGQKKLFVYKTQHFWSQI 250          
The following BLAST results are available for this feature:
BLAST of FC929261 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 124
Match NameE-valueIdentityDescription
GMPAA_XENLA7.144e-3435.89Mannose-1-phosphate guanyltransferase alpha-A OS=X... [more]
GMPAB_XENLA6.047e-3335.57Mannose-1-phosphate guanyltransferase alpha-B OS=X... [more]
GMPPA_XENTR7.898e-3335.89Mannose-1-phosphate guanyltransferase alpha OS=Xen... [more]
GMPPA_DICDI2.298e-3234.13Mannose-1-phosphate guanyltransferase alpha OS=Dic... [more]
GMPPA_MOUSE8.732e-3235.63Mannose-1-phosphate guanyltransferase alpha OS=Mus... [more]
GMPAA_DANRE8.732e-3236.14Mannose-1-phosphate guanyltransferase alpha-A OS=D... [more]
GMPPA_RAT1.945e-3135.22Mannose-1-phosphate guanyltransferase alpha OS=Rat... [more]
GMPPA_PAPAN4.334e-3135.22Mannose-1-phosphate guanyltransferase alpha OS=Pap... [more]
GMPPA_HUMAN4.334e-3135.22Mannose-1-phosphate guanyltransferase alpha OS=Hom... [more]
GMPAB_DANRE1.067e-2935.74Mannose-1-phosphate guanyltransferase alpha-B OS=D... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH3DC11RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH3DC11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929261 ID=FC929261|Name=FC929261|organism=Citrus clementina|type=EST|length=823bp
GCAAAGCAAAAGCGAAGCGCGCGAAGCTCGCCTCATCCGTTGACTGAGCT
GTCGGTCCCGAGTCACGACTCGCGACTCTTGTTTTTGAACTCAGTTGTTT
GCCGTTCGGATCCGGTCTTAATTAAAGGATAAAGCAGGCTCCGTATCACA
ATGAAGGCACTTATTCTTGTTGGAGGGTTCGGAACACGGTTGAGGCCGTT
GACGCTTAGTGTCCCTAAGCCACTTGTTGAATTTGCTAACAAACCCATGA
TCCTGCATCAGATAGAGGCCCTTAAGGCAGTTGGAGTGACTGAAGTAGTT
TTGGCTATTAACTACCAGCCAGAGGTGATGTTGAACTTTTTGAAGGAATT
TGAAGCAAAGCTTGGGATCAAGATCATCTGCTCACAAGAGACTGAGCCAC
TGGGCACTGCTGGTCCTCTGGCTCTGGCTAGAGACAAATTGATTGACGAT
ACTGGTGAGCCATTTTTCGTCCTTAACAGTGATGTTATTAGTGAGTACCC
ATTTGCAGAAATGATTGAATTCCACAAAGCACATGGAGGAGAGGCCTCCA
TCATGGTAACCAAGGTGGATGAGCCATCAAAATATGGTGTGGTGGTTACG
GAAGAGTCTACTGGAAAAGTTGAGAAATTCGTTGAGAAACCTAAATTATT
TGTTGGTAACAAAATTAATGCTGGAATTTATCTTTTGAACCCTGCGGTTC
TTGATCGCATTGAGCTGAGGCCCACCTCCATTGAGAAAGAGGTCTTTCCA
AAAATTGCTTTAGAAGGAAAGCTCTTCGCGATGGTTCTTCCAGGTTTCTG
GATGGACATTGGACAGCCGAGGG
back to top