FC929261

Overview
NameFC929261
Unique NameFC929261
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length823
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig12949 contig Ccv1_Contig12949:141..963. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: STRD_STRGR (Glucose-1-phosphate thymidylyltransferase OS=Streptomyces griseus GN=strD PE=3 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 1.308e-19
Identity = 67/227 (29.52%), Postives = 119/227 (52.42%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFA------MVLPGFWMDIG 813
            MKAL+L GG GTRLRP+T +  K LV  ANKP++ + +EA++A G+ +V + +    + ++  + +  ++ G+K+    +++PLG A  + ++RD L +D    F +   D        + +   +A   +A +M+T+V EP  +GV    +S G+V    EKP     +    G+YL +PA+ + +     S   E+    A++  + A       V+ G+W D G
Sbjct:    1 MKALVLAGGTGTRLRPITHTSAKQLVPVANKPVLFYGLEAIRAAGIIDVGIVVGDTADEIVAAVGD-GSRFGLKVSYIPQSKPLGLAHCVLISRDFLGED---DFIMYLGDNFVVGVVEDSVREFRAARPDAHLMLTRVPEPRSFGVAELSDS-GQVLGLEEKPAHPKSDLALVGVYLFSPAIHEAVAAITPSWRGELEITDAVQWLIDAGRDVRSTVISGYWKDTG 222          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: RFBF_BACSU (Probable glucose-1-phosphate cytidylyltransferase OS=Bacillus subtilis GN=yfnH PE=3 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 9.373e-18
Identity = 70/240 (29.17%), Postives = 114/240 (47.50%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQ--ETEPLG-----------------TAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRI-ELRPTSIEKEVFPKIALEGKLFAMVLPGFWMDI 810
            MKA+IL GG GTR+  +T  +PKPL     KP++ H ++  +  GV E +L + Y+ E +  +  ++E K     + S   E + LG                 TAG +  A+D + D+T   F +   D ++      +I +H+  G  A+  VT +D+ S++G +  E+  G  + F EK        IN G ++L+P V D + +   T  E E    +A +G+L      GFW  I
Sbjct:    1 MKAVILCGGKGTRMSEVTNDIPKPLAMIGGKPILWHIMKIYQYYGVNEFILLLGYKGEKIKEYFLDYEWKHNSLTLDSSTGEVQMLGQPETWKITFLETGVDTLTAGRILQAKDYIGDET---FLLTYGDGLANINLFHLISYHQTKGAAAT--VTGIDKVSQFGTLTVED--GMAKTFSEKTS--SDGIINGGFFVLSPKVFDYLPKDGNTMFEDEPLKNLAKDGELAVYRHYGFWTAI 231          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLGC_CLONN (Glucose-1-phosphate adenylyltransferase OS=Clostridium novyi (strain NT) GN=glgC PE=3 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 8.773e-16
Identity = 67/245 (27.35%), Postives = 118/245 (48.16%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMIL-HQIEALKAVGVTEVVLAINYQPEVMLNFLK-----EFEAKLGIKIICSQETEP------LGTAGPLALARDKLIDDTGEP--FFVLNSDVISEYPFAEMIEFHKAHGGEASIMV--TKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIE-------KEVFPKIALEG-KLFAMVLPGFWMDIG 813
            M A+IL GG GTRL+ LT +  KP V F  K  I+   +      G+  + +   Y+P ++ + +      + + K G   I             +GTA   A+ ++ +  D  +P    VL+ D I +  +++M++FHK    +A+I V    ++E S++G++ T +   K+ +F EKP+    NK + GIY+ N  +L    +  + +E       K + P +   G  L+A    G+W D+G
Sbjct:    6 MLAMILAGGQGTRLKILTKNNAKPAVPFGGKYRIIDFTLSNCSNSGIDTIGVLTQYEPHILNSHIGIGSPWDLDRKRGGVSILPPHMRNDGGNWYMGTAD--AIYQNIMFIDKYDPEYILVLSGDHIYKMDYSKMLQFHKEKNSDATIAVIDVPIEEASRFGIMNTNDD-DKIYEFEEKPEQPKNNKASMGIYIFNWKILKEFLIEDSELEDSDHDFGKNIIPSLLDSGYNLYAYSFNGYWKDVG 247          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLGC_THENN (Glucose-1-phosphate adenylyltransferase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=glgC PE=3 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 5.686e-15
Identity = 71/245 (28.98%), Postives = 117/245 (47.76%), Query Frame = 1
Query:  157 ALILVGGFGTRLRPLTLSVPKPLVEFANK-PMILHQIEALKAVGVTEVVLAINYQPEVMLNFLK-----EFEAK-LGIKII-----CSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASI--MVTKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRI----ELRPTS---IEKEVFPKIALE--GKLFAMVLPGFWMDIGQPR 822
            A+IL GG GTRL  LT  + KP V F  K  +I   +      G+  V +   Y+P V+   +      + + K  G++I+      ++     GTA  +    + L ++  E   VL+ D +    + ++I++H   G + +I  M   ++E S++G+++T+   G++  F EKP     N  + GIY+ N   L R+    E  P S     K+V PKI  E  G L+A    G+W D+G  R
Sbjct:    6 AMILAGGQGTRLGVLTERIAKPAVPFGGKYRLIDFTLSNCVNSGIYRVGVLTQYRPHVLAKHIGIGRPWDLDRKDGGVEILPPYVGRNESDWYKGTANAVYQNLEFLEENDAELVLVLSGDHVYAMNYNDLIDYHLLKGADGTIACMEVPLEEASRFGIMITDVE-GRIVDFEEKPPKPRSNLASLGIYVFNYEFLKRVLIEDENDPNSSHDFGKDVIPKILRENKGSLYAFRFDGYWRDVGTIR 249          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLGC_BACCN (Glucose-1-phosphate adenylyltransferase OS=Bacillus cereus subsp. cytotoxis (strain NVH 391-98) GN=glgC PE=3 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 5.686e-15
Identity = 73/241 (30.29%), Postives = 116/241 (48.13%), Query Frame = 1
Query:  157 ALILVGGFGTRLRPLTLSVPKPLVEFANKPMIL-HQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEA------KLGIKII-----CSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKV--DEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVL-DRIEL---RPTS---IEKEVFPKIALEG-KLFAMVLPGFWMDIG 813
            A++L GG G+RL  LT ++ KP V F  K  I+   +      G+  V +   YQP  + N++    A        G+ ++      S      GTA  +    + L     E   +L+ D I +  +++M+++H A   + SI V +V  DE S++G++ T E    VE F EKP+    N  + GIY+ N A+L + +E+    P S     K+V P +  EG KL A    G+W D+G
Sbjct:    9 AMLLAGGKGSRLSALTKNLAKPAVPFGGKYRIIDFTLSNCSNSGIETVGILTQYQPLELHNYIGIGNAWDLDRVNGGVTVLPPYAEASGVKWYTGTASAIYQNMNFLRQYNPEYVLILSGDHIYKMDYSKMLDYHIAKEADVSISVIEVPWDEASRFGIMNTNEEMEIVE-FEEKPQFPKSNLASMGIYIFNWAILKEYLEMDARNPDSSNDFGKDVLPLLLDEGKKLIAYPFQGYWKDVG 248          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: SPSI_BACSU (Spore coat polysaccharide biosynthesis protein spsI OS=Bacillus subtilis GN=spsI PE=3 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.655e-14
Identity = 67/228 (29.39%), Postives = 107/228 (46.93%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFE--AKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIE-LRPT---SIEKEVFPKIALE-GKLFAMVLPGFWMDIG 813
            MK +IL GG G+RL PLT +V K L+     PMI   I  L+  G+ +++L    Q E M  F K      +LG+ I    +    G +  L+ A+        E F +L  D I E       E  +  G  A +++ +VD+P ++G+   +E   ++   +EKP+    N    GIY+ +  V   IE + P+    +E      + +E  +L   VL G+W+D G
Sbjct:    1 MKGVILAGGNGSRLMPLTKAVNKHLLPVGPYPMIYWSIMKLQEAGIKDILLIS--QKEHMPQFYKLLGNGEELGVTITYQVQPAASGISDGLSYAKRFT---KKESFILLLGDNIFEDSLKPYTERFEQQGKGAKVLLKEVDDPERFGIAEIDEKNKRIRSIIEKPEQPPTNLCVTGIYMYDAEVFSYIEQISPSKRGELEITDVNNLYIENSQLTYDVLSGWWVDAG 223          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLGC_BACWK (Glucose-1-phosphate adenylyltransferase OS=Bacillus weihenstephanensis (strain KBAB4) GN=glgC PE=3 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 2.161e-14
Identity = 71/241 (29.46%), Postives = 115/241 (47.72%), Query Frame = 1
Query:  157 ALILVGGFGTRLRPLTLSVPKPLVEFANKPMIL-HQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEA------KLGIKII-----CSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKV--DEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVL-DRIELRPTSIE------KEVFPKIALEG-KLFAMVLPGFWMDIG 813
            A++L GG G+RL  LT ++ KP V F  K  I+   +      G+  V +   YQP  + N++    A        G+ ++      S      GTA  +    + L     E   +L+ D I +  +++M+++H     + SI V +V  DE S++G++ T E    VE F EKP+    N  + GIY+ N A+L + +E+   + E      K+V P +  EG KL A    G+W D+G
Sbjct:    9 AMLLAGGKGSRLSALTKNLAKPAVPFGGKYRIIDFTLSNCANSGIETVGILTQYQPLELHNYIGIGNAWDLDRVNGGVTVLPPYAESSGVKWYTGTASAIYQNLNYLSQYEPEYVLILSGDHIYKMDYSKMLDYHIEKEADVSISVIEVPWDEASRFGIMNTNEEMEVVE-FEEKPQFPRSNLASMGIYIFNWAILKEYLEMDARNPESSNDFGKDVLPLLLDEGKKLMAYPFEGYWKDVG 248          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLGC_BACHK (Glucose-1-phosphate adenylyltransferase OS=Bacillus thuringiensis subsp. konkukian GN=glgC PE=3 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 2.161e-14
Identity = 70/241 (29.05%), Postives = 114/241 (47.30%), Query Frame = 1
Query:  157 ALILVGGFGTRLRPLTLSVPKPLVEFANKPMIL-HQIEALKAVGVTEVVLAINYQPEVMLNFLK-----EFEAKLGIKIICSQETEP------LGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKV--DEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVL-DRIELRPTSIE------KEVFPKIALEG-KLFAMVLPGFWMDIG 813
            A++L GG G+RL  LT ++ KP V F  K  I+   +      G+  V +   YQP  + N++      + +   G   +     E        GTA  +    + L     E   +L+ D I +  +++M+++H     + SI V +V  DE S++G++ T E    VE F EKP+    N  + GIY+ N A+L + +E+   + E      K+V P +  EG KL A    G+W D+G
Sbjct:    9 AMLLAGGKGSRLSALTKNLAKPAVPFGGKYRIIDFTLSNCANSGIETVGILTQYQPLELHNYIGIGNAWDLDRVSGGVTVLPPYAESSGVKWYTGTASAIYQNLNYLSQYEPEYVLILSGDHIYKMDYSKMLDYHIEKEADVSISVIEVPWDEASRFGIMNTNEEMEIVE-FEEKPQFPRSNLASMGIYIFNWAILKEYLEMDARNPESSNDFGKDVLPLLLDEGKKLMAYPFEGYWKDVG 248          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLGC_BACCZ (Glucose-1-phosphate adenylyltransferase OS=Bacillus cereus (strain ZK / E33L) GN=glgC PE=3 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 2.161e-14
Identity = 70/241 (29.05%), Postives = 114/241 (47.30%), Query Frame = 1
Query:  157 ALILVGGFGTRLRPLTLSVPKPLVEFANKPMIL-HQIEALKAVGVTEVVLAINYQPEVMLNFLK-----EFEAKLGIKIICSQETEP------LGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKV--DEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVL-DRIELRPTSIE------KEVFPKIALEG-KLFAMVLPGFWMDIG 813
            A++L GG G+RL  LT ++ KP V F  K  I+   +      G+  V +   YQP  + N++      + +   G   +     E        GTA  +    + L     E   +L+ D I +  +++M+++H     + SI V +V  DE S++G++ T E    VE F EKP+    N  + GIY+ N A+L + +E+   + E      K+V P +  EG KL A    G+W D+G
Sbjct:    9 AMLLAGGKGSRLSALTKNLAKPAVPFGGKYRIIDFTLSNCANSGIETVGILTQYQPLELHNYIGIGNAWDLDRVSGGVTVLPPYAESSGVKWYTGTASAIYQNLNYLSQYEPEYVLILSGDHIYKMDYSKMLDYHIEKEADVSISVIEVPWDEASRFGIMNTNEEMEIVE-FEEKPQFPRSNLASMGIYIFNWAILKEYLEMDARNPESSNDFGKDVLPLLLDEGKKLMAYPFEGYWKDVG 248          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLGC_BACCQ (Glucose-1-phosphate adenylyltransferase OS=Bacillus cereus (strain Q1) GN=glgC PE=3 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 2.161e-14
Identity = 70/241 (29.05%), Postives = 114/241 (47.30%), Query Frame = 1
Query:  157 ALILVGGFGTRLRPLTLSVPKPLVEFANKPMIL-HQIEALKAVGVTEVVLAINYQPEVMLNFLK-----EFEAKLGIKIICSQETEP------LGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKV--DEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVL-DRIELRPTSIE------KEVFPKIALEG-KLFAMVLPGFWMDIG 813
            A++L GG G+RL  LT ++ KP V F  K  I+   +      G+  V +   YQP  + N++      + +   G   +     E        GTA  +    + L     E   +L+ D I +  +++M+++H     + SI V +V  DE S++G++ T E    VE F EKP+    N  + GIY+ N A+L + +E+   + E      K+V P +  EG KL A    G+W D+G
Sbjct:    9 AMLLAGGKGSRLSALTKNLAKPAVPFGGKYRIIDFTLSNCANSGIETVGILTQYQPLELHNYIGIGNAWDLDRVSGGVTVLPPYAESSGVKWYTGTASAIYQNLNYLSQYEPEYVLILSGDHIYKMDYSKMLDYHIEKEADVSISVIEVPWDEASRFGIMNTNEEMEIVE-FEEKPQFPRSNLASMGIYIFNWAILKEYLEMDARNPESSNDFGKDVLPLLLDEGKKLMAYPFEGYWKDVG 248          
The following BLAST results are available for this feature:
BLAST of FC929261 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 124
Match NameE-valueIdentityDescription
STRD_STRGR1.308e-1929.52Glucose-1-phosphate thymidylyltransferase OS=Strep... [more]
RFBF_BACSU9.373e-1829.17Probable glucose-1-phosphate cytidylyltransferase ... [more]
GLGC_CLONN8.773e-1627.35Glucose-1-phosphate adenylyltransferase OS=Clostri... [more]
GLGC_THENN5.686e-1528.98Glucose-1-phosphate adenylyltransferase OS=Thermot... [more]
GLGC_BACCN5.686e-1530.29Glucose-1-phosphate adenylyltransferase OS=Bacillu... [more]
SPSI_BACSU1.655e-1429.39Spore coat polysaccharide biosynthesis protein sps... [more]
GLGC_BACWK2.161e-1429.46Glucose-1-phosphate adenylyltransferase OS=Bacillu... [more]
GLGC_BACHK2.161e-1429.05Glucose-1-phosphate adenylyltransferase OS=Bacillu... [more]
GLGC_BACCZ2.161e-1429.05Glucose-1-phosphate adenylyltransferase OS=Bacillu... [more]
GLGC_BACCQ2.161e-1429.05Glucose-1-phosphate adenylyltransferase OS=Bacillu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH3DC11RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH3DC11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929261 ID=FC929261|Name=FC929261|organism=Citrus clementina|type=EST|length=823bp
GCAAAGCAAAAGCGAAGCGCGCGAAGCTCGCCTCATCCGTTGACTGAGCT
GTCGGTCCCGAGTCACGACTCGCGACTCTTGTTTTTGAACTCAGTTGTTT
GCCGTTCGGATCCGGTCTTAATTAAAGGATAAAGCAGGCTCCGTATCACA
ATGAAGGCACTTATTCTTGTTGGAGGGTTCGGAACACGGTTGAGGCCGTT
GACGCTTAGTGTCCCTAAGCCACTTGTTGAATTTGCTAACAAACCCATGA
TCCTGCATCAGATAGAGGCCCTTAAGGCAGTTGGAGTGACTGAAGTAGTT
TTGGCTATTAACTACCAGCCAGAGGTGATGTTGAACTTTTTGAAGGAATT
TGAAGCAAAGCTTGGGATCAAGATCATCTGCTCACAAGAGACTGAGCCAC
TGGGCACTGCTGGTCCTCTGGCTCTGGCTAGAGACAAATTGATTGACGAT
ACTGGTGAGCCATTTTTCGTCCTTAACAGTGATGTTATTAGTGAGTACCC
ATTTGCAGAAATGATTGAATTCCACAAAGCACATGGAGGAGAGGCCTCCA
TCATGGTAACCAAGGTGGATGAGCCATCAAAATATGGTGTGGTGGTTACG
GAAGAGTCTACTGGAAAAGTTGAGAAATTCGTTGAGAAACCTAAATTATT
TGTTGGTAACAAAATTAATGCTGGAATTTATCTTTTGAACCCTGCGGTTC
TTGATCGCATTGAGCTGAGGCCCACCTCCATTGAGAAAGAGGTCTTTCCA
AAAATTGCTTTAGAAGGAAAGCTCTTCGCGATGGTTCTTCCAGGTTTCTG
GATGGACATTGGACAGCCGAGGG
back to top