FC929261

Overview
NameFC929261
Unique NameFC929261
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length823
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig12949 contig Ccv1_Contig12949:141..963. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLGC_THEM4 (Glucose-1-phosphate adenylyltransferase OS=Thermosipho melanesiensis (strain BI429 / DSM 12029) GN=glgC PE=3 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 2.022e-12
Identity = 59/240 (24.58%), Postives = 109/240 (45.42%), Query Frame = 1
Query:  157 ALILVGGFGTRLRPLTLSVPKPLVEFANK-PMILHQIEALKAVGVTEVVLAINYQPEVM---LNFLKEFEAKL---GIKIICSQETEPLGT----AGPLALARDKLIDDTGEPFFV-LNSDVISEYPFAEMIEFHKAHG--GEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIE-------KEVFPKIALEGKLFAMVLPGFWMDIG 813
            ALIL GG GTRL  LT  + KP V+F  K  +I   +      G+ ++ +   Y+P ++   +   K ++      G+ I+    TE +G           +  + +D     + V L+ D I    + E++++H A    G  + M   + E +++G++VT +   ++ +F EKPK       + GIY+     +  + +     E       K++ PKI    +++A    G+W D+G
Sbjct:    6 ALILAGGQGTRLGVLTEKIAKPAVQFGGKYRLIDFTMSNCVNSGIYKIGVLTQYKPHLLNRHIGIGKPWDLDRKDGGVTILQPYSTEKVGVWYKGTADAVYSNIEFVDSYSPDYVVILSGDHIYSMDYNELVDYHVAKSALGTVACMEVPLSEANRFGIMVT-DLENRIIEFQEKPKFPKSTLASLGIYVFQWNFIREVLMEDAKDENSTHDFGKDIIPKIINTKRVYAFPFEGYWKDVG 244          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLGC_FUSNN (Glucose-1-phosphate adenylyltransferase OS=Fusobacterium nucleatum subsp. nucleatum GN=glgC PE=3 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 2.022e-12
Identity = 68/243 (27.98%), Postives = 110/243 (45.27%), Query Frame = 1
Query:  157 ALILVGGFGTRLRPLTLSVPKPLVEFANKPMIL-HQIEALKAVGVTEVVLAINYQPEVMLNFLK-----EFEAKLGIKIICSQETEP-------LGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTK---VDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLN----PAVLDRIELRPTS---IEKEVFPKIALEG-KLFAMVLPGFWMDIG 813
            A+IL GG GTRL+ LT  + KP V F  K  I+   +      G+  V +   Y+P ++ N +      + +   G   +    T          GTA  +      + +   E   +L+ D I +  + +M++FH     +A+I V K   VD PS +G++ T++    + +F EKPK    +  + GIY+ N       LD  E  P S     K + P +  +G K+FA    G+W D+G
Sbjct:   10 AMILAGGQGTRLKELTEDLAKPAVAFGGKYRIIDFTLTNCSNSGIDTVGVLTQYEPRILNNHIGRGSPWDLDRMDGGVTVLQPHTRKNDEKGWYKGTANAIYQNIKFIEEYDPEYVLILSGDHIYKMNYDKMLQFHIQKDADATIGVFKVPLVDAPS-FGIMNTKDDM-SIYEFEEKPKEPKSDLASMGIYIFNWKLLKKYLDEDEKDPNSSNDFGKNIIPNMLNDGKKMFAYPFKGYWRDVG 250          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLGC_EUBE2 (Glucose-1-phosphate adenylyltransferase OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=glgC PE=3 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 2.022e-12
Identity = 67/241 (27.80%), Postives = 114/241 (47.30%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMIL-HQIEALKAVGVTEVVLAINYQP-----EVMLNFLKEFEAKL-GIKII----CSQETE-PLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASI--MVTKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYL-----LNPAVLDRIELRPTSIEKEVFPKIALEGK-LFAMVLPGFWMDIG 813
            M A++L GG G+RL  LT  V KP V F  K  I+   +      G+  V +   YQP      + +    + +  + G+ ++     SQ +E   GTA  +    + +     E   +L+ D I +  +  M+++HKA+  + +I  M   ++E S++GVVVT ++  K+ +F EKP+    N  + GIY+     L  A++   + +     K V P      K +FA    G+W D+G
Sbjct:    6 MIAMLLAGGQGSRLGVLTSKVAKPAVAFGGKYRIIDFPLSNCINSGIDTVGVLTQYQPLRLNTHIGIGIPWDLDRNVGGVSVLPPYEKSQNSEWYTGTANAIYQNLEYMEQYHPEYVLILSGDHIYKMDYKIMLDYHKANNADITIAAMPVPMEEASRFGVVVT-DNDNKITEFEEKPEHPKSNLASMGIYIFSWKVLKDALIKLKDQQECDFGKHVIPYCFNNNKRIFAYEYNGYWKDVG 245          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLGC_CLOBA (Glucose-1-phosphate adenylyltransferase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=glgC PE=3 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.641e-12
Identity = 67/243 (27.57%), Postives = 115/243 (47.33%), Query Frame = 1
Query:  157 ALILVGGFGTRLRPLTLSVPKPLVEFANKPMIL-HQIEALKAVGVTEVVLAINYQP-----EVMLNFLKEFEAK-LGIKIICSQETEP-----LGTAGPLALARDKLIDDTGEPFFV--LNSDVISEYPFAEMIEFHKAHGGEASIMVTK--VDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRI-------ELRPTSIEKEVFPKIALE-GKLFAMVLPGFWMDIG 813
            A+IL GG G+RL  LT  + KP V F  K  I+   +      G+  V +   Y+P      + +    + + K  G+ I+   + E       GTA   A+ ++    D  +P +V  L+ D I +  + +M+EFHK    +A+I V +  V+E S++G++ T +    + +F EKPK+   N  + GIY+ N   L +        +       K++ P +  + GK+ A    G+W D+G
Sbjct:    8 AMILAGGQGSRLGVLTKKLAKPAVPFGGKYRIIDFPLSNCANSGIYTVGVLTQYKPLELNAHIGIGLPWDLDRKDGGVSILPPYQEEKGGNWYKGTAN--AIYQNIEFVDRYDPEYVLILSGDHIYKMNYTKMLEFHKEKNADATIGVIEVPVNEASRFGIMNTRDDM-SIYEFEEKPKIPKSNLASMGIYIFNWKTLKKYLRNDEANKSSSNDFGKDIIPSMLNDGGKMVAYPFEGYWKDVG 247          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: RMLA2_SHIFL (Glucose-1-phosphate thymidylyltransferase 2 OS=Shigella flexneri GN=rmlA2 PE=3 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 3.450e-12
Identity = 63/235 (26.81%), Postives = 105/235 (44.68%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEP-FFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVL---------DRIELRPTSIEKEVFP----KIALEGKLFAMVLPGFWMDIG 813
            MK +IL GG GTRL P+T  V K L+   +KPMI + +  L   G+ E+++    + +     L    ++ GI++  +++  P G A    +    L    GEP   VL  ++     F+  +    A    A++   +V +P ++GVV  +++   +    EKPK    N    G+Y  +  V+         +R EL  TSI +         + L G+ FA      W+D G
Sbjct:    1 MKGIILAGGSGTRLHPITRGVSKQLLPIYDKPMIYYPLSVLMLAGIREILIITTPEDKGYFQRLLGDGSEFGIQLEYAEQPSPDGLAQAFIIGETFL---NGEPSCLVLGDNIFFGQGFSPKLRHVAARTEGATVFGYQVMDPERFGVVEFDDNFRAI-SLEEKPKQPKSNWAVTGLYFYDSKVVEYAKQVKPSERGELEITSINQMYLEAGNLTVELLGRGFA------WLDTG 225          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: RMLA2_ECOLI (Glucose-1-phosphate thymidylyltransferase 2 OS=Escherichia coli (strain K12) GN=rmlA2 PE=1 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 3.450e-12
Identity = 63/235 (26.81%), Postives = 105/235 (44.68%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEP-FFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVL---------DRIELRPTSIEKEVFP----KIALEGKLFAMVLPGFWMDIG 813
            MK +IL GG GTRL P+T  V K L+   +KPMI + +  L   G+ E+++    + +     L    ++ GI++  +++  P G A    +    L    GEP   VL  ++     F+  +    A    A++   +V +P ++GVV  +++   +    EKPK    N    G+Y  +  V+         +R EL  TSI +         + L G+ FA      W+D G
Sbjct:    1 MKGIILAGGSGTRLHPITRGVSKQLLPIYDKPMIYYPLSVLMLAGIREILIITTPEDKGYFQRLLGDGSEFGIQLEYAEQPSPDGLAQAFIIGETFL---NGEPSCLVLGDNIFFGQGFSPKLRHVAARTEGATVFGYQVMDPERFGVVEFDDNFRAI-SLEEKPKQPKSNWAVTGLYFYDSKVVEYAKQVKPSERGELEITSINQMYLEAGNLTVELLGRGFA------WLDTG 225          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLGC_CLOBB (Glucose-1-phosphate adenylyltransferase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=glgC PE=3 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 4.506e-12
Identity = 67/243 (27.57%), Postives = 115/243 (47.33%), Query Frame = 1
Query:  157 ALILVGGFGTRLRPLTLSVPKPLVEFANKPMIL-HQIEALKAVGVTEVVLAINYQP-----EVMLNFLKEFEAK-LGIKIICSQETEP-----LGTAGPLALARDKLIDDTGEPFFV--LNSDVISEYPFAEMIEFHKAHGGEASIMVTK--VDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRI-------ELRPTSIEKEVFPKIALE-GKLFAMVLPGFWMDIG 813
            A+IL GG G+RL  LT  + KP V F  K  I+   +      G+  V +   Y+P      + +    + + K  G+ I+   + E       GTA   A+ ++    D  +P +V  L+ D I +  + +M+EFHK    +A+I V +  V+E S++G++ T +    + +F EKPK+   N  + GIY+ N   L +        +       K++ P +  + GK+ A    G+W D+G
Sbjct:    8 AMILAGGQGSRLGVLTKKLAKPAVPFGGKYRIIDFPLSNCANSGIYTVGVLTQYKPLELNAHIGIGLPWDLDRKDGGVSILPPYQEEKGGNWYKGTAN--AIYQNIEFVDRYDPEYVLILSGDHIYKMNYTKMLEFHKEKNADATIGVIEVPVNEASRFGIMNTRDDM-SIYEFEEKPKIPKSNLASMGIYIFNWKTLKKYLRNDEANKGSSNDFGKDIIPSMLNDGGKMVAYPFEGYWKDVG 247          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: RMLA_STRMU (Glucose-1-phosphate thymidylyltransferase OS=Streptococcus mutans GN=rmlA PE=3 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 5.885e-12
Identity = 59/232 (25.43%), Postives = 105/232 (45.26%), Query Frame = 1
Query:  151 MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLD---------RIELRPTSIEKEVFPKIALEGKLFAMVLP-GF-WMDIG 813
            MK +IL GG GTRL PLT +  K L+   +KPMI + +  L   G+ ++++    Q       L +  ++ GIK+  +++  P G A    +  + + DD      +L  ++      + M++   +    A++   +V +P ++GVV  +     +    EKP+    +    G+Y  + +V+D         R EL  T + K    +    G L   V+  GF W+D G
Sbjct:    1 MKGIILAGGSGTRLYPLTRAASKQLMPVYDKPMIYYPLSTLMLAGIKDILIISTPQDLPRFKELLQDGSEFGIKLSYAEQPSPDGLAQAFIIGEEFIGDD--HVALILGDNIYYGPGLSRMLQKAASKESGATVFGYQVKDPERFGVVEFDNDRNAI-SIEEKPEHPKSHYAVTGLYFYDNSVVDIAKNIKPSPRGELEITDVNKAYLDR----GDLSVEVMERGFAWLDTG 225          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLGC_CLOB8 (Glucose-1-phosphate adenylyltransferase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=glgC PE=3 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 5.885e-12
Identity = 68/242 (28.10%), Postives = 109/242 (45.04%), Query Frame = 1
Query:  157 ALILVGGFGTRLRPLTLSVPKPLVEFANKPMIL-HQIEALKAVGVTEVVLAINYQPEVMLNFLKEFE------AKLGIKIICSQETEP-----LGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKV--DEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEK--------EVFPKIALEG-KLFAMVLPGFWMDIG 813
            A+IL GG G+RL  LT  + KP V F  K  I+   +      G+  V +   Y+P  +   +   E      A  G+ ++   + E       GTA  +    + +     E   +L+ D I +  + +M++FHK    EA+I V +V  DE S++G++ T E    + +F EKPK    N  + GIY+ N   L +  LR    +K         + P +   G K+ A    G+W D+G
Sbjct:    8 AMILAGGQGSRLGVLTKKLAKPAVPFGGKYRIIDFPLSNCSNSGIYTVGVLTQYKPLELNAHIGIGEAWDLDRAHGGVHVLPPYQEEKGGEWYKGTANAIYQNIEFVDRYDPEYILILSGDHIYKMDYTKMLDFHKEKQAEATIAVIEVPMDEASRFGIMNTREDL-SIYEFEEKPKNPKNNLASMGIYIFNWKTLKKY-LREDESDKTSKNDFGMNIIPSMLGNGNKMVAYPFKGYWKDVG 247          
BLAST of FC929261 vs. ExPASy Swiss-Prot
Match: GLGC_CLOPS (Glucose-1-phosphate adenylyltransferase OS=Clostridium perfringens (strain SM101 / Type A) GN=glgC PE=3 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 7.685e-12
Identity = 67/241 (27.80%), Postives = 111/241 (46.06%), Query Frame = 1
Query:  157 ALILVGGFGTRLRPLTLSVPKPLVEFANKPMIL-HQIEALKAVGVTEVVLAINYQP-----EVMLNFLKEFEAK-LGIKIICSQETEP-----LGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKV--DEPSKYGVVVTEESTGKVEKFVEKPKLFVGNKINAGIYLLNPAVLDRI----ELRPTS---IEKEVFPKIALEG-KLFAMVLPGFWMDIG 813
            A+IL GG G+RL  LT ++ KP V F  K  I+   +      G+  V +   Y+P      + +    + + +  G+ I+   + E       GTA  +    + +     E   +L+ D I +  + +M+E HK    +A+I V  V   E S++G++ T E    + +F EKP+       + GIY+ N  +L +     EL P+S     K + PK+   G KL A    G+W D+G
Sbjct:    8 AMILAGGQGSRLGVLTKNLAKPAVPFGGKYRIIDFPLSNCSNSGIYTVGVLTQYKPLKLNEHIGIGDTWDLDRRDGGVSILPPYQKEKGGDWYKGTANAIYQNIEFIERYDPEYVLILSGDHIYKMDYDKMLEMHKQKEADATIAVINVPMHEASRFGIMNTNEDL-SIYEFEEKPEHPKSTNASMGIYIFNWKILKKFLEEDELDPSSSNDFGKNIIPKMLNSGKKLIAYPFNGYWKDVG 247          
The following BLAST results are available for this feature:
BLAST of FC929261 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 124
Match NameE-valueIdentityDescription
GLGC_THEM42.022e-1224.58Glucose-1-phosphate adenylyltransferase OS=Thermos... [more]
GLGC_FUSNN2.022e-1227.98Glucose-1-phosphate adenylyltransferase OS=Fusobac... [more]
GLGC_EUBE22.022e-1227.80Glucose-1-phosphate adenylyltransferase OS=Eubacte... [more]
GLGC_CLOBA2.641e-1227.57Glucose-1-phosphate adenylyltransferase OS=Clostri... [more]
RMLA2_SHIFL3.450e-1226.81Glucose-1-phosphate thymidylyltransferase 2 OS=Shi... [more]
RMLA2_ECOLI3.450e-1226.81Glucose-1-phosphate thymidylyltransferase 2 OS=Esc... [more]
GLGC_CLOBB4.506e-1227.57Glucose-1-phosphate adenylyltransferase OS=Clostri... [more]
RMLA_STRMU5.885e-1225.43Glucose-1-phosphate thymidylyltransferase OS=Strep... [more]
GLGC_CLOB85.885e-1228.10Glucose-1-phosphate adenylyltransferase OS=Clostri... [more]
GLGC_CLOPS7.685e-1227.80Glucose-1-phosphate adenylyltransferase OS=Clostri... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH3DC11RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH3DC11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929261 ID=FC929261|Name=FC929261|organism=Citrus clementina|type=EST|length=823bp
GCAAAGCAAAAGCGAAGCGCGCGAAGCTCGCCTCATCCGTTGACTGAGCT
GTCGGTCCCGAGTCACGACTCGCGACTCTTGTTTTTGAACTCAGTTGTTT
GCCGTTCGGATCCGGTCTTAATTAAAGGATAAAGCAGGCTCCGTATCACA
ATGAAGGCACTTATTCTTGTTGGAGGGTTCGGAACACGGTTGAGGCCGTT
GACGCTTAGTGTCCCTAAGCCACTTGTTGAATTTGCTAACAAACCCATGA
TCCTGCATCAGATAGAGGCCCTTAAGGCAGTTGGAGTGACTGAAGTAGTT
TTGGCTATTAACTACCAGCCAGAGGTGATGTTGAACTTTTTGAAGGAATT
TGAAGCAAAGCTTGGGATCAAGATCATCTGCTCACAAGAGACTGAGCCAC
TGGGCACTGCTGGTCCTCTGGCTCTGGCTAGAGACAAATTGATTGACGAT
ACTGGTGAGCCATTTTTCGTCCTTAACAGTGATGTTATTAGTGAGTACCC
ATTTGCAGAAATGATTGAATTCCACAAAGCACATGGAGGAGAGGCCTCCA
TCATGGTAACCAAGGTGGATGAGCCATCAAAATATGGTGTGGTGGTTACG
GAAGAGTCTACTGGAAAAGTTGAGAAATTCGTTGAGAAACCTAAATTATT
TGTTGGTAACAAAATTAATGCTGGAATTTATCTTTTGAACCCTGCGGTTC
TTGATCGCATTGAGCTGAGGCCCACCTCCATTGAGAAAGAGGTCTTTCCA
AAAATTGCTTTAGAAGGAAAGCTCTTCGCGATGGTTCTTCCAGGTTTCTG
GATGGACATTGGACAGCCGAGGG
back to top