FC930520

Overview
NameFC930520
Unique NameFC930520
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length751
Libraries
Library NameType
PostHarvC1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC930520_ssr589 microsatellite FC930520_ssr589:589..600. BLAST: Citrus ESTs to Prunus persica proteins V1
FC930520_ssr612 microsatellite FC930520_ssr612:612..623. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig15166 contig Ccv1_Contig15166:1..748. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC930520 vs. ExPASy Swiss-Prot
Match: FKBP2_ASPOR (FK506-binding protein 2 OS=Aspergillus oryzae GN=fpr2 PE=3 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 8.332e-15
Identity = 40/84 (47.62%), Postives = 53/84 (63.10%), Query Frame = 2
Query:  251 VDVHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVGEVAKLTCKPEYAYGSAGSPPDVPPDATLIFEVELV 502
            V +HY+G+L   G  FD++++ N+   F++G G VI+ WD  L  M +GE   LT  PEY YGS G  P +P  ATLIFE ELV
Sbjct:   42 VQMHYKGTLQSDGSEFDSSYKRNSPLKFKVGSGMVIKGWDEGLLDMCIGEKRTLTIPPEYGYGSRGVGP-IPGGATLIFETELV 124          
BLAST of FC930520 vs. ExPASy Swiss-Prot
Match: FKB2B_RHIOR (FK506-binding protein 2B OS=Rhizopus oryzae GN=FKBP3 PE=3 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 8.332e-15
Identity = 40/90 (44.44%), Postives = 54/90 (60.00%), Query Frame = 2
Query:  251 VDVHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVGEVAKLTCKPEYAYGSAGSPPDVPPDATLIFEVELVACRPRK 520
            + +HY G+L +TGE FD++ + N  F F LG G VI+ WD  L  M VGE  +L   P   YG  G+   +P  ATL+FEVEL+  +P K
Sbjct:   50 LSMHYTGTLFDTGEKFDSSLDRNEPFVFTLGAGQVIQGWDQGLLGMCVGEKRRLVIPPHLGYGERGAGGVIPGGATLVFEVELLEIKPGK 139          
BLAST of FC930520 vs. ExPASy Swiss-Prot
Match: FKB1B_MOUSE (Peptidyl-prolyl cis-trans isomerase FKBP1B OS=Mus musculus GN=Fkbp1b PE=2 SV=3)

HSP 1 Score: 80.8777 bits (198), Expect = 8.332e-15
Identity = 38/83 (45.78%), Postives = 56/83 (67.47%), Query Frame = 2
Query:  257 VHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVGEVAKLTCKPEYAYGSAGSPPDVPPDATLIFEVELVA 505
            VHY G L + G+ FD++ + N  F F +GK  VI+ ++     M +G+ AKLTC P+ AYG+ G P  +PP+ATLIF+VEL++
Sbjct:   25 VHYTGML-QNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGTAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLS 106          
BLAST of FC930520 vs. ExPASy Swiss-Prot
Match: FKBP_YEAST (FK506-binding protein 1 OS=Saccharomyces cerevisiae GN=FPR1 PE=1 SV=2)

HSP 1 Score: 80.4925 bits (197), Expect = 1.088e-14
Identity = 41/103 (39.81%), Postives = 63/103 (61.17%), Query Frame = 2
Query:  194 KIVRQAKPDALSPTEDLPLVDVHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVGEVAKLTCKPEYAYGSAGSPPDVPPDATLIFEVELV 502
            KI R +  D  +  +   LV +HY G+L E G+ FD++ +  + F   +G G VI+ WD+ +  + VGE A+LT    YAYG  G P  +PP++TL+F+VEL+
Sbjct:   10 KIDRISPGDGATFPKTGDLVTIHYTGTL-ENGQKFDSSVDRGSPFQCNIGVGQVIKGWDVGIPKLSVGEKARLTIPGPYAYGPRGFPGLIPPNSTLVFDVELL 111          
BLAST of FC930520 vs. ExPASy Swiss-Prot
Match: FKB22_ARATH (FK506-binding protein 2-2 OS=Arabidopsis thaliana GN=FKBP15-2 PE=2 SV=2)

HSP 1 Score: 80.4925 bits (197), Expect = 1.088e-14
Identity = 43/97 (44.33%), Postives = 54/97 (55.67%), Query Frame = 2
Query:  251 VDVHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVGEVAKLTCKPEYAYGSAGSPPDVPPDATLIFEVELVAC--RPRKGSSLG 535
            + VHY G L + G VFD++ E    F F+LG G VI+ WD  L    VGE  KL    +  YG  GSPP +P  ATLIF+ EL+A   +P  G   G
Sbjct:   55 IKVHYRGKLTD-GTVFDSSFERGDPFEFKLGSGQVIKGWDQGLLGACVGEKRKLKIPAKLGYGEQGSPPTIPGGATLIFDTELIAVNEKPAGGEEYG 150          
BLAST of FC930520 vs. ExPASy Swiss-Prot
Match: FKB1B_RAT (Peptidyl-prolyl cis-trans isomerase FKBP1B OS=Rattus norvegicus GN=Fkbp1b PE=2 SV=3)

HSP 1 Score: 80.4925 bits (197), Expect = 1.088e-14
Identity = 38/82 (46.34%), Postives = 55/82 (67.07%), Query Frame = 2
Query:  257 VHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVGEVAKLTCKPEYAYGSAGSPPDVPPDATLIFEVELV 502
            VHY G L + G+ FD++ + N  F F +GK  VI+ ++     M +G+ AKLTC P+ AYG+ G P  +PP+ATLIF+VEL+
Sbjct:   25 VHYTGML-QNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELL 105          
BLAST of FC930520 vs. ExPASy Swiss-Prot
Match: FKB1B_HUMAN (Peptidyl-prolyl cis-trans isomerase FKBP1B OS=Homo sapiens GN=FKBP1B PE=1 SV=2)

HSP 1 Score: 80.4925 bits (197), Expect = 1.088e-14
Identity = 38/82 (46.34%), Postives = 55/82 (67.07%), Query Frame = 2
Query:  257 VHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVGEVAKLTCKPEYAYGSAGSPPDVPPDATLIFEVELV 502
            VHY G L + G+ FD++ + N  F F +GK  VI+ ++     M +G+ AKLTC P+ AYG+ G P  +PP+ATLIF+VEL+
Sbjct:   25 VHYTGML-QNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELL 105          
BLAST of FC930520 vs. ExPASy Swiss-Prot
Match: FKB1B_BOVIN (Peptidyl-prolyl cis-trans isomerase FKBP1B OS=Bos taurus GN=FKBP1B PE=1 SV=2)

HSP 1 Score: 80.4925 bits (197), Expect = 1.088e-14
Identity = 38/82 (46.34%), Postives = 55/82 (67.07%), Query Frame = 2
Query:  257 VHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVGEVAKLTCKPEYAYGSAGSPPDVPPDATLIFEVELV 502
            VHY G L + G+ FD++ + N  F F +GK  VI+ ++     M +G+ AKLTC P+ AYG+ G P  +PP+ATLIF+VEL+
Sbjct:   25 VHYTGML-QNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELL 105          
BLAST of FC930520 vs. ExPASy Swiss-Prot
Match: FKBP6_BOVIN (FK506-binding protein 6 OS=Bos taurus GN=FKBP6 PE=2 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.421e-14
Identity = 40/114 (35.09%), Postives = 67/114 (58.77%), Query Frame = 2
Query:  161 IDLTGDEGVIKKIVRQAKPDALSPTEDLPLVDVHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVGEVAKLTCKPEYAYGSAGSPPDVPPDATLIFEVELV 502
            +D++GD GV+K ++R+   + ++P      V V Y G L    + FD+     T    +LG+   +   ++ L SM+ GE+A+   KP YAYG+ G PP +PP+ T++FE+EL+
Sbjct:   29 LDISGDRGVLKDVIREGAGELVTPDAS---VLVKYSGYLEHMDKPFDSNCFRKTPRLMKLGEDITLWGMELGLLSMRRGELARFLFKPTYAYGTLGCPPLIPPNTTVLFEIELL 139          
BLAST of FC930520 vs. ExPASy Swiss-Prot
Match: FKB1A_ASPFU (FK506-binding protein 1A OS=Aspergillus fumigatus GN=fpr1A PE=3 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.856e-14
Identity = 38/90 (42.22%), Postives = 56/90 (62.22%), Query Frame = 2
Query:  251 VDVHYEGSLAETGEVFDTTHEDNTVFSFELGKGSVIRAWDIALRSMKVGEVAKLTCKPEYAYGSAGSPPDVPPDATLIFEVELVACRPRK 520
            V +HY G L + G  FD++ + N  F  ++G G VI+ WD  +  M +GE A LT  P+Y YG+ G PP +P ++TLIFEVEL+    ++
Sbjct:   23 VTIHYTGRLTD-GSKFDSSVDRNEPFQTQIGTGRVIKGWDEGVPQMSLGEKAVLTITPDYGYGARGFPPVIPGNSTLIFEVELLGINNKR 111          
The following BLAST results are available for this feature:
BLAST of FC930520 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 82
Match NameE-valueIdentityDescription
FKBP2_ASPOR8.332e-1547.62FK506-binding protein 2 OS=Aspergillus oryzae GN=f... [more]
FKB2B_RHIOR8.332e-1544.44FK506-binding protein 2B OS=Rhizopus oryzae GN=FKB... [more]
FKB1B_MOUSE8.332e-1545.78Peptidyl-prolyl cis-trans isomerase FKBP1B OS=Mus ... [more]
FKBP_YEAST1.088e-1439.81FK506-binding protein 1 OS=Saccharomyces cerevisia... [more]
FKB22_ARATH1.088e-1444.33FK506-binding protein 2-2 OS=Arabidopsis thaliana ... [more]
FKB1B_RAT1.088e-1446.34Peptidyl-prolyl cis-trans isomerase FKBP1B OS=Ratt... [more]
FKB1B_HUMAN1.088e-1446.34Peptidyl-prolyl cis-trans isomerase FKBP1B OS=Homo... [more]
FKB1B_BOVIN1.088e-1446.34Peptidyl-prolyl cis-trans isomerase FKBP1B OS=Bos ... [more]
FKBP6_BOVIN1.421e-1435.09FK506-binding protein 6 OS=Bos taurus GN=FKBP6 PE=... [more]
FKB1A_ASPFU1.856e-1442.22FK506-binding protein 1A OS=Aspergillus fumigatus ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34008D10EF PostHarvC1 Citrus clementina cDNA clone C34008D10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC930520 ID=FC930520; Name=FC930520; organism=Citrus clementina; type=EST; length=751bp
GACTCACTAGACGCCTATGGCCACCAAAATCCACGGCAATTTCTCCCGAT
TTATTGTCCCCGAGTCAATCGGTCAACTCGATCTCTCTTTTACGGTCGAT
AATTTTCATCTCATCACGATACGGTAGGGTTTTAAGCATTGAGAAGTTAT
GGGTGATTCAATTGATTTGACGGGTGATGAAGGTGTCATCAAGAAGATCG
TAAGGCAAGCTAAACCTGATGCTCTCTCTCCTACTGAGGACCTTCCTCTT
GTTGATGTTCATTATGAAGGCAGTCTTGCTGAAACTGGTGAAGTTTTCGA
TACCACACATGAAGACAATACTGTATTTTCTTTTGAGCTTGGGAAGGGTT
CAGTGATTCGGGCTTGGGATATTGCATTAAGAAGCATGAAGGTTGGGGAG
GTTGCAAAACTCACTTGCAAGCCAGAATATGCCTATGGCAGTGCAGGATC
TCCTCCAGATGTCCCACCTGATGCGACACTTATTTTTGAGGTGGAGTTGG
TGGCCTGCAGGCCAAGGAAAGGTTCTAGTCTTGGTAGCGTATCGGAAGAG
AGAGCCAGGCTAGAGGAGCTTAAGAGGCAAAGAGAGCTTGCTGCTGCTGC
GAAAGAGGAGGAGAAGAAGAAGAGAGAAGAAGCCNAAGCTGCAGCAGCTG
CTCGTATTCAAGCCAAATGGAAGCCAAGAAGGTCAGGAAAGGGGAAAGCA
AGGGGAAATAGGGTATGTATCCCGCTCATATGGATAGCGATATGTGTGAT
G
back to top