FC931069

Overview
NameFC931069
Unique NameFC931069
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length668
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10254 contig Ccv1_Contig10254:1..670. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_RHOCA (Adenosylhomocysteinase OS=Rhodobacter capsulatus GN=ahcY PE=3 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 9.928e-43
Identity = 91/158 (57.59%), Postives = 109/158 (68.99%), Query Frame = 1
Query:  163 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTD 636
            ++ VKD+  A+FGR E+++AE EMPGLMACR EFGPSQP KGA+I GSLHMTIQTAVLIETL ALGA+VRW SCNIFSTQDH               KGETL+EYW  T+K   + P G  ++I+DDGGDATL I  G + E    +T  +  P S D
Sbjct:    3 DYIVKDIKLAEFGRKELDIAETEMPGLMACREEFGPSQPLKGARIAGSLHMTIQTAVLIETLKALGADVRWASCNIFSTQDHAAAAIAAGGTPVFAVKGETLEEYWAYTDKIFQF-PEGTCNMILDDGGDATLYILLGARVEA--GETDLIATPTSED 157          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_METCA (Adenosylhomocysteinase OS=Methylococcus capsulatus GN=ahcY PE=3 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 9.928e-43
Identity = 88/152 (57.89%), Postives = 107/152 (70.39%), Query Frame = 1
Query:  136 SVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE 591
            +V  +AS  + KV DLS A +GR EI +AE EMPGLMA R E+  +QP KGA+I GSLHMTIQTAVLIETL ALGAEVRW SCNIFSTQDH              +KGE+L +YW  T + L+W    GP++I+DDGGDATLL+  G +AE+
Sbjct:    3 AVANAASFDDHKVADLSLAGWGRKEIAIAETEMPGLMAIREEYRAAQPLKGARIAGSLHMTIQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAIAADGIPVFAYKGESLDDYWEYTHRILEWPGDVGPNMILDDGGDATLLVTLGARAEK 154          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_COREF (Adenosylhomocysteinase OS=Corynebacterium efficiens GN=ahcY PE=3 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 9.928e-43
Identity = 90/170 (52.94%), Postives = 108/170 (63.53%), Query Frame = 1
Query:  163 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH--------XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEF 648
            +FKV DLS A+ GR +I LAE EMPGLM  R E+   QP KGA+I GS+HMT+QTAVLIETLTALGAEVRW SCNIFSTQD                       WKGETL EYWWC  +   W  G  P++I+DDGGDAT+ +  G +    YEK G +P P + D+ E+
Sbjct:    6 DFKVADLSLAEAGRHQIRLAEYEMPGLMQLRREYAEEQPLKGARIAGSIHMTVQTAVLIETLTALGAEVRWASCNIFSTQDEAAAAIVVGDGTPEDPQGVPVFAWKGETLDEYWWCINQIFSW-EGELPNMILDDGGDATMAVIRGRE----YEKAGVVPQPEANDSDEY 170          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_SYNPX (Adenosylhomocysteinase OS=Synechococcus sp. (strain WH8102) GN=ahcY PE=3 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 1.297e-42
Identity = 84/145 (57.93%), Postives = 103/145 (71.03%), Query Frame = 1
Query:  157 GREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE 591
            G +  + D++QA FGR E+++AE EMPGLMA R ++G  +P KGA+I GSLHMTIQTA LIETL  LGAEVRW SCNIFSTQDH               KGETL+EYW  T + L+WG GG P++I+DDGGDAT L+  G KAE+
Sbjct:   14 GVDCVIADINQAAFGRKELDIAETEMPGLMALREKYGTEKPLKGARIAGSLHMTIQTACLIETLVELGAEVRWASCNIFSTQDHAAAAIAAQNIPVFAVKGETLEEYWEYTHRILEWGDGGSPNMILDDGGDATGLVMLGSKAEQ 158          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_XYLFA (Adenosylhomocysteinase OS=Xylella fastidiosa GN=ahcY PE=3 SV=2)

HSP 1 Score: 172.555 bits (436), Expect = 1.693e-42
Identity = 85/152 (55.92%), Postives = 107/152 (70.39%), Query Frame = 1
Query:  145 KSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDW----GPGGGPDLIVDDGGDATLLIHEGVKAE 588
            +++    +K+ D+S  D+GR EI++AE EMPGLM+ R ++   QP KG ++TGSLHMTIQTAVLIETL  +GA+VRW SCNIFSTQDH              WKGETL+EYW CT +AL +    G   GP+LIVDDGGDATLLIH+G + E
Sbjct:    6 QTSPNTHYKIADISLTDWGRKEIDIAEHEMPGLMSIRRKYASKQPLKGVRVTGSLHMTIQTAVLIETLKDIGADVRWASCNIFSTQDHAAAAIATSGTPVFAWKGETLEEYWDCTLQALTFTLSDGTLTGPELIVDDGGDATLLIHKGYELE 157          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_ACISJ (Adenosylhomocysteinase OS=Acidovorax sp. (strain JS42) GN=ahcY PE=3 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 1.693e-42
Identity = 88/144 (61.11%), Postives = 103/144 (71.53%), Query Frame = 1
Query:  172 VKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGP----GGGPDLIVDDGGDATLLIHEGVKAEE 591
            + D+S AD+GR EI +AE EMPGLMA R EF   QP KGA+ITGSLHMTIQTAVLIETL ALGA+VRW SCNIFSTQDH               KGETL +YW  T +  D+GP    G GP++I+DDGGDATLL+H G +AE+
Sbjct:   13 IADISLADWGRKEIRIAETEMPGLMAIREEFAAKQPLKGARITGSLHMTIQTAVLIETLKALGADVRWASCNIFSTQDHAAAAIAATGTPVFAIKGETLVDYWDYTHRIFDFGPKGSEGEGPNMILDDGGDATLLMHLGKRAEK 156          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_PROM3 (Adenosylhomocysteinase OS=Prochlorococcus marinus (strain MIT 9303) GN=ahcY PE=3 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 2.888e-42
Identity = 86/155 (55.48%), Postives = 104/155 (67.10%), Query Frame = 1
Query:  124 AMALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 588
            A+  S+    +  ++ V D+  ADFGR E+ +AE EMPGLMA R + G  +P KGA+I GSLHMTIQT VLIETL ALGA+VRW SCNIFSTQDH               KGETL EYW  T + L+WG GG P++I+DDGGDAT L+  G KAE
Sbjct:    3 AVPTSMASLQAPPQYVVADIDLADFGRKELSIAETEMPGLMALRVKHGSEKPLKGARIAGSLHMTIQTGVLIETLVALGADVRWASCNIFSTQDHAAAAIAASGVPVFATKGETLDEYWAYTHRILEWGDGGTPNMILDDGGDATGLVMLGSKAE 157          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_MESSB (Adenosylhomocysteinase OS=Mesorhizobium sp. (strain BNC1) GN=ahcY PE=3 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 2.888e-42
Identity = 85/142 (59.86%), Postives = 102/142 (71.83%), Query Frame = 1
Query:  163 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 588
            ++ V D+S A +GR EIE+AE EMPGLMACR EFG ++P KGA+ITGSLHMTIQTAVLIETL +LGAEVRW SCNIFSTQDH               KGETL+EYW  T++   W  G   ++I+DDGGDAT+ I  G +AE
Sbjct:    5 DYVVADMSLAAWGRKEIEIAETEMPGLMACREEFGEAKPLKGARITGSLHMTIQTAVLIETLKSLGAEVRWASCNIFSTQDHAAAAIAETGTPVFAVKGETLEEYWTYTDRIFQWPDGQPSNMILDDGGDATMYILLGARAE 146          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_AZOSE (Adenosylhomocysteinase OS=Azoarcus sp. (strain EbN1) GN=ahcY PE=3 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 2.888e-42
Identity = 86/143 (60.14%), Postives = 102/143 (71.33%), Query Frame = 1
Query:  163 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE 591
            ++ V DL+ A +GR EI +AE EMPGLMA R EF   QP KGA+ITGSLHMTIQTAVLIETLTALGAEVRW SCNIFSTQDH               KGE+L +YW  T +  +W  GG  ++I+DDGGDATLL+H G +AE+
Sbjct:   10 DYVVADLALAGWGRKEIRIAETEMPGLMAIREEFAVVQPLKGARITGSLHMTIQTAVLIETLTALGAEVRWASCNIFSTQDHAAAAIAASGVPVFAVKGESLADYWDYTHRIFEWRDGGYSNMILDDGGDATLLLHLGARAEK 152          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_TRIVA (Adenosylhomocysteinase OS=Trichomonas vaginalis PE=3 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 3.772e-42
Identity = 92/183 (50.27%), Postives = 114/183 (62.30%), Query Frame = 1
Query:  145 KSASGR--EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQD---------HXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVL 660
            KS +G   E+++ D++    GR E+ LAE EMPGLM  R  +  S+P KG +I+GSLHMT+QTAVLIETLTALGA+VRW SCNIFSTQD                        WKGETL EYW  T +AL W  G GP  +VDDGGDATLLI +G +    +E  G +P+P   DN E++ VL
Sbjct:    4 KSPAGAPFEYRIADINLHVLGRKELTLAEKEMPGLMVLRERYSASKPLKGVRISGSLHMTVQTAVLIETLTALGADVRWASCNIFSTQDTAAAAIVVGPTGTPEKPAGIPVFAWKGETLPEYWENTYRALTWPDGQGPQQVVDDGGDATLLISKGFE----FETAGAVPEPTEADNLEYRCVL 182          
The following BLAST results are available for this feature:
BLAST of FC931069 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 235
Match NameE-valueIdentityDescription
SAHH_RHOCA9.928e-4357.59Adenosylhomocysteinase OS=Rhodobacter capsulatus G... [more]
SAHH_METCA9.928e-4357.89Adenosylhomocysteinase OS=Methylococcus capsulatus... [more]
SAHH_COREF9.928e-4352.94Adenosylhomocysteinase OS=Corynebacterium efficien... [more]
SAHH_SYNPX1.297e-4257.93Adenosylhomocysteinase OS=Synechococcus sp. (strai... [more]
SAHH_XYLFA1.693e-4255.92Adenosylhomocysteinase OS=Xylella fastidiosa GN=ah... [more]
SAHH_ACISJ1.693e-4261.11Adenosylhomocysteinase OS=Acidovorax sp. (strain J... [more]
SAHH_PROM32.888e-4255.48Adenosylhomocysteinase OS=Prochlorococcus marinus ... [more]
SAHH_MESSB2.888e-4259.86Adenosylhomocysteinase OS=Mesorhizobium sp. (strai... [more]
SAHH_AZOSE2.888e-4260.14Adenosylhomocysteinase OS=Azoarcus sp. (strain EbN... [more]
SAHH_TRIVA3.772e-4250.27Adenosylhomocysteinase OS=Trichomonas vaginalis PE... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101A12EF PostHarvP1 Citrus clementina cDNA clone C34101A12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931069 ID=FC931069|Name=FC931069|organism=Citrus clementina|type=EST|length=668bp
GGCTCACACCCACTCTATCTCTCTCGCTTGTACAATCATTCACTTTGTTT
GGTTGGTTTCCAAAGAGAGAGTAGAGTGCCCTCTCTTCCTTCTTCCTTTT
AGATCTATCAATTCTATTAATAAGCCATGGCTTTGTCCGTCCAGAAATCC
GCTAGCGGTCGTGAATTCAAGGTGAAGGATCTGTCCCAGGCTGACTTCGG
CCGCCTCGAAATCGAGTTGGCCGAAGTCGAAATGCCGGGGCTCATGGCTT
GCCGCGCCGAGTTCGGCCCTTCACAGCCCTTCAAAGGAGCCAAGATCACC
GGTTCACTCCACATGACCATCCAGACCGCCGTCCTCATCGAGACCCTCAC
CGCTCTCGGCGCCGAAGTCCGCTGGTGCTCCTGCAACATCTTCTCAACCC
AAGACCACGCGGCCGCCGCCATCGCACGTGACTCCGCCTCCGTCTTTGCC
TGGAAGGGTGAGACCCTCCAGGAGTACTGGTGGTGCACGGAGAAAGCCCT
GGACTGGGGTCCCGGCGGCGGCCCAGATCTCATCGTCGATGACGGTGGTG
ACGCCACGTTGTTGATCCACGAGGGAGTCAAAGCTGAGGAGATCTACGAG
AAGACCGGGAAGTTGCCCGACCCGGCCTCCACCGACAACGCCGAGTTTCA
GATTGTTTTGACTATCAT
back to top