FC931069

Overview
NameFC931069
Unique NameFC931069
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length668
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10254 contig Ccv1_Contig10254:1..670. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_PLAYO (Adenosylhomocysteinase OS=Plasmodium yoelii yoelii GN=PY02893 PE=3 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 4.916e-50
Identity = 95/168 (56.55%), Postives = 120/168 (71.43%), Query Frame = 1
Query:  169 KVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH-XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGG-GPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTI 666
            K+KDLS A FG+L++E++E EMPG+M  R E+   +PFKGAKITG LHMTI+TA+LIETL  LGA +RWCSCNIFST D+               W+GETL+EYWWC EKAL WG  G GPDLIVDDG DA+ L+H+G + E++YE+   LPDP S  N E +  L++
Sbjct:    7 KIKDLSLAPFGKLQMEISETEMPGIMTIREEYEKLKPFKGAKITGCLHMTIETALLIETLQKLGARIRWCSCNIFSTLDYAAAAVSTLENVSVFAWRGETLEEYWWCVEKALTWGENGEGPDLIVDDGADASYLVHKGAEYEKLYEEKKILPDPESGKNEEERCFLSL 174          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_BACFR (Adenosylhomocysteinase OS=Bacteroides fragilis GN=ahcY PE=3 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 9.270e-49
Identity = 92/141 (65.25%), Postives = 109/141 (77.30%), Query Frame = 1
Query:  166 FKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 588
            +KV D++ ADFGR EI+LAE EMPGLMA R ++G S+P KGA+I GSLHMTIQTAVLIETL ALGAEVRWCSCNI+STQDH              WKGETL +YWWCT +AL++  G GP +IVDDGGDAT++IH G +AE
Sbjct:   26 YKVADITLADFGRKEIDLAEKEMPGLMALREKYGESKPLKGARIMGSLHMTIQTAVLIETLVALGAEVRWCSCNIYSTQDHAAAAIAASGVAVFAWKGETLADYWWCTLQALNFEGGKGPTVIVDDGGDATMMIHVGYEAE 166          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_PLACH (Adenosylhomocysteinase OS=Plasmodium chabaudi GN=PC000295.02.0 PE=3 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 2.065e-48
Identity = 92/168 (54.76%), Postives = 120/168 (71.43%), Query Frame = 1
Query:  169 KVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH-XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGG-GPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTI 666
            K+KDLS A FG+L++E++E EMPGLM  R E+   +P KGAKITG LHMTI+TA+L+ETL  LGA++RWCSCNI+ST D+               W+GETL+EYWWC EKAL WG  G GPDLIVDDG DA+ L+H+G + E++YE+   LPDP +  N E +  L++
Sbjct:    7 KIKDLSLAPFGKLQMEISETEMPGLMTIREEYEKLKPLKGAKITGCLHMTIETALLMETLQKLGAKLRWCSCNIYSTLDYAAAAVSTLENVSVFAWRGETLEEYWWCVEKALTWGENGEGPDLIVDDGADASYLVHKGAEYEKLYEEKKILPDPETGKNEEERCFLSL 174          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_BACTN (Adenosylhomocysteinase OS=Bacteroides thetaiotaomicron GN=ahcY PE=3 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 3.523e-48
Identity = 91/141 (64.54%), Postives = 108/141 (76.60%), Query Frame = 1
Query:  166 FKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 588
            +KV D++ ADFGR EI+LAE EMPGLMA R ++G S+P KGA+I GSLHMTIQTAVLIETL ALGAEVRWCSCNI+STQDH              WKGE L +YWWCT +AL++  G GP++IVDDGGDAT++IH G  AE
Sbjct:   15 YKVADITLADFGRKEIDLAEKEMPGLMALREKYGESKPLKGARIMGSLHMTIQTAVLIETLVALGAEVRWCSCNIYSTQDHAAAAIAASGVAVFAWKGENLADYWWCTLQALNFPGGKGPNVIVDDGGDATMMIHVGYDAE 155          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_CHLL2 (Adenosylhomocysteinase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=ahcY PE=3 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 1.339e-47
Identity = 94/159 (59.12%), Postives = 112/159 (70.44%), Query Frame = 1
Query:  151 ASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPA 627
            A+   +KV D++ A++GR EIE+AE EMPGLMA R ++   +P KGA+ITGSLHMTIQTAVLIETL  LGAEVRW SCNIFSTQDH              WKGE+L EYWWCT + L++  G GP+LIVDDGGDATL+IH G K E   E   K+P  A
Sbjct:    5 ATALAYKVADITLAEWGRKEIEIAEKEMPGLMATRRKYAGQKPLKGARITGSLHMTIQTAVLIETLVDLGAEVRWASCNIFSTQDHAAAAIAAAGIPVFAWKGESLDEYWWCTRQILEFEDGKGPNLIVDDGGDATLMIHLGYKIENNPELLEKVPGNA 163          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_DESVV (Adenosylhomocysteinase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=ahcY PE=3 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 2.982e-47
Identity = 96/182 (52.75%), Postives = 120/182 (65.93%), Query Frame = 1
Query:  130 ALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH-XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPA----STDNAEFQIVL 660
            A   QK     + KV D+S AD+GR +++L+E EMPGLM    ++G ++P KG K+TGSLHMTIQTA+LI TL  LGA++RW SCNIFSTQDH               WKGETL++YWWCTE AL W  G GPDL+VDDGGDATL IH+GV+ E          DP+    + DN EFQI++
Sbjct:    4 AKRAQKLDLSLDHKVADMSLADYGRKDLQLSEREMPGLMELIRKYGGTKPLKGLKVTGSLHMTIQTAMLIRTLYELGADIRWASCNIFSTQDHAAAAIAASGMAKVFAWKGETLEDYWWCTEMALTWPDGSGPDLLVDDGGDATLFIHKGVEVEN---------DPSLLKKAYDNKEFQIIM 176          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_DESVH (Adenosylhomocysteinase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=ahcY PE=3 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 2.982e-47
Identity = 96/182 (52.75%), Postives = 120/182 (65.93%), Query Frame = 1
Query:  130 ALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH-XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPA----STDNAEFQIVL 660
            A   QK     + KV D+S AD+GR +++L+E EMPGLM    ++G ++P KG K+TGSLHMTIQTA+LI TL  LGA++RW SCNIFSTQDH               WKGETL++YWWCTE AL W  G GPDL+VDDGGDATL IH+GV+ E          DP+    + DN EFQI++
Sbjct:    4 AKRAQKLDLSLDHKVADMSLADYGRKDLQLSEREMPGLMELIRKYGGTKPLKGLKVTGSLHMTIQTAMLIRTLYELGADIRWASCNIFSTQDHAAAAIAASGMAKVFAWKGETLEDYWWCTEMALTWPDGSGPDLLVDDGGDATLFIHKGVEVEN---------DPSLLKKAYDNKEFQIIM 176          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_RHOPT (Adenosylhomocysteinase OS=Rhodopseudomonas palustris (strain TIE-1) GN=ahcY PE=3 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 8.677e-47
Identity = 90/147 (61.22%), Postives = 107/147 (72.79%), Query Frame = 1
Query:  148 SASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 588
            +A   ++ VKD+  A+FGR EI LAE EMPGLMA R E+GP QP KGAKI GSLHMTIQTAVLIETL ALGAEVRW SCNI+STQDH               KGETL++YW  T K  DW  GG P++I+DDGGDAT+ +H+G++AE
Sbjct:    2 TAKFTDYIVKDIGLAEFGRKEISLAETEMPGLMATREEYGPKQPLKGAKIAGSLHMTIQTAVLIETLVALGAEVRWVSCNIYSTQDHAAAAIAAAGIPVFAVKGETLKDYWDYTAKLFDWSDGGTPNMILDDGGDATMFVHQGLRAE 148          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_RHOPA (Adenosylhomocysteinase OS=Rhodopseudomonas palustris GN=ahcY PE=3 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 8.677e-47
Identity = 90/147 (61.22%), Postives = 107/147 (72.79%), Query Frame = 1
Query:  148 SASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 588
            +A   ++ VKD+  A+FGR EI LAE EMPGLMA R E+GP QP KGAKI GSLHMTIQTAVLIETL ALGAEVRW SCNI+STQDH               KGETL++YW  T K  DW  GG P++I+DDGGDAT+ +H+G++AE
Sbjct:    2 TAKFTDYIVKDIGLAEFGRKEISLAETEMPGLMATREEYGPKQPLKGAKIAGSLHMTIQTAVLIETLVALGAEVRWVSCNIYSTQDHAAAAIAAAGIPVFAVKGETLKDYWDYTAKLFDWSDGGTPNMILDDGGDATMFVHQGLRAE 148          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_MYCUA (Adenosylhomocysteinase OS=Mycobacterium ulcerans (strain Agy99) GN=ahcY PE=3 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 1.133e-46
Identity = 95/179 (53.07%), Postives = 120/179 (67.04%), Query Frame = 1
Query:  154 SGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH---------XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGP-DLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVL 660
            +G +FK+ DLS ADFGR E+ +AE EMPGLM+ R E+   QP KGA+I+GSLHMT+QTAVLIETLTALGAEVRW SCNIFSTQDH                       WKGE+L+EYWWC E+ L W     P ++I+DDGGDAT+L+  G++    YEK G +P     D+AE+++ L
Sbjct:   14 NGIDFKIADLSLADFGRKELRIAEHEMPGLMSLRREYAEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAAAAVVVGPHGTPEEPKGVPVFAWKGESLEEYWWCAEQMLTWPDSDKPANMILDDGGDATMLVLRGMQ----YEKAGVVPPAEEDDSAEWKVFL 188          
The following BLAST results are available for this feature:
BLAST of FC931069 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 235
Match NameE-valueIdentityDescription
SAHH_PLAYO4.916e-5056.55Adenosylhomocysteinase OS=Plasmodium yoelii yoelii... [more]
SAHH_BACFR9.270e-4965.25Adenosylhomocysteinase OS=Bacteroides fragilis GN=... [more]
SAHH_PLACH2.065e-4854.76Adenosylhomocysteinase OS=Plasmodium chabaudi GN=P... [more]
SAHH_BACTN3.523e-4864.54Adenosylhomocysteinase OS=Bacteroides thetaiotaomi... [more]
SAHH_CHLL21.339e-4759.12Adenosylhomocysteinase OS=Chlorobium limicola (str... [more]
SAHH_DESVV2.982e-4752.75Adenosylhomocysteinase OS=Desulfovibrio vulgaris s... [more]
SAHH_DESVH2.982e-4752.75Adenosylhomocysteinase OS=Desulfovibrio vulgaris (... [more]
SAHH_RHOPT8.677e-4761.22Adenosylhomocysteinase OS=Rhodopseudomonas palustr... [more]
SAHH_RHOPA8.677e-4761.22Adenosylhomocysteinase OS=Rhodopseudomonas palustr... [more]
SAHH_MYCUA1.133e-4653.07Adenosylhomocysteinase OS=Mycobacterium ulcerans (... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101A12EF PostHarvP1 Citrus clementina cDNA clone C34101A12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931069 ID=FC931069|Name=FC931069|organism=Citrus clementina|type=EST|length=668bp
GGCTCACACCCACTCTATCTCTCTCGCTTGTACAATCATTCACTTTGTTT
GGTTGGTTTCCAAAGAGAGAGTAGAGTGCCCTCTCTTCCTTCTTCCTTTT
AGATCTATCAATTCTATTAATAAGCCATGGCTTTGTCCGTCCAGAAATCC
GCTAGCGGTCGTGAATTCAAGGTGAAGGATCTGTCCCAGGCTGACTTCGG
CCGCCTCGAAATCGAGTTGGCCGAAGTCGAAATGCCGGGGCTCATGGCTT
GCCGCGCCGAGTTCGGCCCTTCACAGCCCTTCAAAGGAGCCAAGATCACC
GGTTCACTCCACATGACCATCCAGACCGCCGTCCTCATCGAGACCCTCAC
CGCTCTCGGCGCCGAAGTCCGCTGGTGCTCCTGCAACATCTTCTCAACCC
AAGACCACGCGGCCGCCGCCATCGCACGTGACTCCGCCTCCGTCTTTGCC
TGGAAGGGTGAGACCCTCCAGGAGTACTGGTGGTGCACGGAGAAAGCCCT
GGACTGGGGTCCCGGCGGCGGCCCAGATCTCATCGTCGATGACGGTGGTG
ACGCCACGTTGTTGATCCACGAGGGAGTCAAAGCTGAGGAGATCTACGAG
AAGACCGGGAAGTTGCCCGACCCGGCCTCCACCGACAACGCCGAGTTTCA
GATTGTTTTGACTATCAT
back to top