FC931069

Overview
NameFC931069
Unique NameFC931069
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length668
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10254 contig Ccv1_Contig10254:1..670. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_MYCPA (Adenosylhomocysteinase OS=Mycobacterium paratuberculosis GN=ahcY PE=3 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 1.253e-45
Identity = 97/185 (52.43%), Postives = 119/185 (64.32%), Query Frame = 1
Query:  154 SGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH---------XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDW-----GPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTI 666
            +G EFKV DLS AD+GR +IEL+E EMPGLM+ R E+   QP KGA+I+GSLHMT+QTAVLIETL ALGAEVRW SCNIFSTQDH                       WKGETL+EYWW  E+AL W     G     ++I+DDGGDAT+L+  G +    YEK G +P     D+AE ++ L +
Sbjct:   14 NGIEFKVADLSLADYGRRDIELSEQEMPGLMSLRREYHDVQPLKGARISGSLHMTVQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAVVVGPHGTPEEPRGVPVFAWKGETLEEYWWAAEQALTWPPLADGTEAPANMILDDGGDATMLVLRGAQ----YEKAGVVPPDDEDDSAEHRVFLNL 194          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_METEP (Adenosylhomocysteinase OS=Methylobacterium extorquens (strain PA1) GN=ahcY PE=3 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 1.253e-45
Identity = 94/170 (55.29%), Postives = 113/170 (66.47%), Query Frame = 1
Query:  151 ASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVL 660
            A   ++ VKD+  AD+GR EI +AE EMPGLM+ RAE+G SQP KGAKI GSLHMTIQTAVLIETL ALGA++RW SCNI+STQDH               KGETL EYW  T K  DW  GG P++I+DDGGDAT+ +H G++AE     T  L  P S +   F  +L
Sbjct:    2 AVANDYIVKDIGLADYGRKEISIAETEMPGLMSTRAEYGASQPLKGAKIAGSLHMTIQTAVLIETLKALGADIRWVSCNIYSTQDHAAAAIAAAGIPVFAVKGETLTEYWDYTSKLFDWHDGGMPNMILDDGGDATMFVHLGLRAEN--GDTAFLDKPESEEEEVFFALL 169          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_METC4 (Adenosylhomocysteinase OS=Methylobacterium chloromethanicum (strain CM4 / NCIMB 13688) GN=ahcY PE=3 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 1.253e-45
Identity = 94/170 (55.29%), Postives = 113/170 (66.47%), Query Frame = 1
Query:  151 ASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVL 660
            A   ++ VKD+  AD+GR EI +AE EMPGLM+ RAE+G SQP KGAKI GSLHMTIQTAVLIETL ALGA++RW SCNI+STQDH               KGETL EYW  T K  DW  GG P++I+DDGGDAT+ +H G++AE     T  L  P S +   F  +L
Sbjct:    2 AVANDYIVKDIGLADYGRKEISIAETEMPGLMSTRAEYGASQPLKGAKIAGSLHMTIQTAVLIETLKALGADIRWVSCNIYSTQDHAAAAIAAAGIPVFAVKGETLTEYWDYTSKLFDWHDGGMPNMILDDGGDATMFVHLGLRAEN--GDTAFLDKPESEEEEVFFALL 169          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_RHOPS (Adenosylhomocysteinase OS=Rhodopseudomonas palustris (strain BisB5) GN=ahcY PE=3 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 2.137e-45
Identity = 93/171 (54.39%), Postives = 115/171 (67.25%), Query Frame = 1
Query:  148 SASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVL 660
            +A   ++ VKD+  A+FGR EI LAE EMPGLMA R E+GP QP KGA+I GSLHMTIQTAVLIETLTALGA+VRW SCNI+STQDH               KGE+L++YW  T +  DW  GG P++I+DDGGDAT+ +H G++AE     T  L  P S +   F  +L
Sbjct:    2 TAKFTDYIVKDIGLAEFGRKEISLAETEMPGLMATREEYGPKQPLKGARIAGSLHMTIQTAVLIETLTALGADVRWVSCNIYSTQDHAAAAIAAAGIPVFAIKGESLEDYWDYTARMFDWHGGGTPNMILDDGGDATMYVHLGLRAEN--GDTAFLDKPGSDEEVIFFALL 170          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_NOCFA (Adenosylhomocysteinase OS=Nocardia farcinica GN=ahcY PE=3 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 2.137e-45
Identity = 94/180 (52.22%), Postives = 120/180 (66.67%), Query Frame = 1
Query:  154 SGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH---------XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTI 666
            +G ++KV DL+ A+FGR EI LAE EMPGLMA R E+   QP KGA+I+GSLHMT+QTAVLIETLTALGA+VRW SCNIFSTQDH                       WKGETL+EYWW  E+ L W PG   ++I+DDGGDAT+L+  G +    +EK G +P   +  +AE+++ L +
Sbjct:   18 NGIDYKVADLTLAEFGRKEIRLAEHEMPGLMALRREYADVQPLKGARISGSLHMTVQTAVLIETLTALGAQVRWASCNIFSTQDHAAAAVVVGPHGTVEEPKGVSVFAWKGETLEEYWWAAEQMLTW-PGEPANMILDDGGDATMLVLRGAQ----FEKAGVVPPEDADHSAEYKVFLNL 192          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_METPB (Adenosylhomocysteinase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=ahcY PE=3 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 2.791e-45
Identity = 93/170 (54.71%), Postives = 113/170 (66.47%), Query Frame = 1
Query:  151 ASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVL 660
            A+  ++ V+D+  AD+GR EI +AE EMPGLMA RAE+G SQP KGAKI GSLHMTIQTAVLIETL  LGA++RW SCNI+STQDH               KGETL EYW  T K  DW  GG P++I+DDGGDAT+ +H G++AE     T  L  P S +   F  +L
Sbjct:    2 AAANDYIVRDIGLADYGRKEISIAETEMPGLMATRAEYGASQPLKGAKIAGSLHMTIQTAVLIETLKHLGADIRWVSCNIYSTQDHAAAAIAAAGIPVFAVKGETLTEYWDYTSKLFDWHDGGMPNMILDDGGDATMFVHLGLRAEN--GDTAFLDKPESEEEEVFFALL 169          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_SINMW (Adenosylhomocysteinase OS=Sinorhizobium medicae (strain WSM419) GN=ahcY PE=3 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 4.761e-45
Identity = 89/146 (60.96%), Postives = 105/146 (71.92%), Query Frame = 1
Query:  151 ASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 588
            ++ +++ V D+  ADFGR EI +AE EMPGLMACR EFG S+P KGA+ITGSLHMTIQTAVLIETL ALGAEVRW SCNIFSTQDH               KGETL+EYW  T+K   W  GG  ++I+DDGGDAT+ I  G +AE
Sbjct:    2 SANQDYIVADIGLADFGRKEIAIAETEMPGLMACREEFGASKPLKGARITGSLHMTIQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAIAASGVPVFAVKGETLEEYWTYTDKIFQWADGGVSNMILDDGGDATMYILLGARAE 147          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_PROVI (Adenosylhomocysteinase OS=Prosthecochloris vibrioformis (strain DSM 265) (strain DSM 265) GN=ahcY PE=3 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 4.761e-45
Identity = 88/157 (56.05%), Postives = 114/157 (72.61%), Query Frame = 1
Query:  148 SASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE---EIYEKTG 609
            +A+  ++KV D+S A++GR EI++AE EMPGLMA R ++   +P  G++I+GSLHMTIQTAVLIETL  LGA+VRW SCNIFSTQDH              WKGE+L+EYWWCT + LD+G G GP+LIVDDGGDAT++I  G K E    +++K G
Sbjct:    4 AATALDYKVADISLAEWGRKEIDIAEKEMPGLMAIRNKYKGQKPLAGSRISGSLHMTIQTAVLIETLVELGADVRWASCNIFSTQDHAAAAIAVTGVPVFAWKGESLEEYWWCTRQILDFGNGLGPNLIVDDGGDATMMIILGYKVENNPSMFDKGG 160          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_METS4 (Adenosylhomocysteinase OS=Methylobacterium sp. (strain 4-46) GN=ahcY PE=3 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 4.761e-45
Identity = 92/165 (55.76%), Postives = 111/165 (67.27%), Query Frame = 1
Query:  154 SGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEF 648
            S +++ V+D+  ADFGR EI +AE EMPGLMA RAE+  SQP KGAKI GSLHMTIQTAVLIETL ALGA++RW SCNI+STQDH               KGETL EYW  T +  DW  GG P++I+DDGGDAT+ +H G++AE     T  L  P S +   F
Sbjct:    3 SNQDYIVRDIGLADFGRKEIAIAETEMPGLMAVRAEYAASQPLKGAKIAGSLHMTIQTAVLIETLKALGADIRWVSCNIYSTQDHAAAAIAAAGIPVFAVKGETLTEYWDYTARLFDWHDGGMPNMILDDGGDATMFVHAGLRAER--GDTAFLDAPGSEEEEIF 165          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_CHLCH (Adenosylhomocysteinase OS=Chlorobium chlorochromatii (strain CaD3) GN=ahcY PE=3 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 6.218e-45
Identity = 92/159 (57.86%), Postives = 107/159 (67.30%), Query Frame = 1
Query:  151 ASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPA 627
            A    +KV D+S A++GR EIE+AE EMPGLMA R ++   +P KGA+I GSLHMTIQTAVLIETL  LGA VRW SCNIFSTQDH              WKGETL EYWWCT + L++  G GP+LIVDDGGDATL+I  G K E   +   K P  A
Sbjct:    5 AEALAYKVADISLAEWGRKEIEIAEKEMPGLMALRKKYAGQKPLKGARIAGSLHMTIQTAVLIETLVDLGANVRWASCNIFSTQDHAAAAIAQAGVPVFAWKGETLDEYWWCTRQILEFDGGLGPNLIVDDGGDATLMIILGHKIENDPKMLDKTPGNA 163          
The following BLAST results are available for this feature:
BLAST of FC931069 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 235
Match NameE-valueIdentityDescription
SAHH_MYCPA1.253e-4552.43Adenosylhomocysteinase OS=Mycobacterium paratuberc... [more]
SAHH_METEP1.253e-4555.29Adenosylhomocysteinase OS=Methylobacterium extorqu... [more]
SAHH_METC41.253e-4555.29Adenosylhomocysteinase OS=Methylobacterium chlorom... [more]
SAHH_RHOPS2.137e-4554.39Adenosylhomocysteinase OS=Rhodopseudomonas palustr... [more]
SAHH_NOCFA2.137e-4552.22Adenosylhomocysteinase OS=Nocardia farcinica GN=ah... [more]
SAHH_METPB2.791e-4554.71Adenosylhomocysteinase OS=Methylobacterium populi ... [more]
SAHH_SINMW4.761e-4560.96Adenosylhomocysteinase OS=Sinorhizobium medicae (s... [more]
SAHH_PROVI4.761e-4556.05Adenosylhomocysteinase OS=Prosthecochloris vibriof... [more]
SAHH_METS44.761e-4555.76Adenosylhomocysteinase OS=Methylobacterium sp. (st... [more]
SAHH_CHLCH6.218e-4557.86Adenosylhomocysteinase OS=Chlorobium chlorochromat... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101A12EF PostHarvP1 Citrus clementina cDNA clone C34101A12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931069 ID=FC931069|Name=FC931069|organism=Citrus clementina|type=EST|length=668bp
GGCTCACACCCACTCTATCTCTCTCGCTTGTACAATCATTCACTTTGTTT
GGTTGGTTTCCAAAGAGAGAGTAGAGTGCCCTCTCTTCCTTCTTCCTTTT
AGATCTATCAATTCTATTAATAAGCCATGGCTTTGTCCGTCCAGAAATCC
GCTAGCGGTCGTGAATTCAAGGTGAAGGATCTGTCCCAGGCTGACTTCGG
CCGCCTCGAAATCGAGTTGGCCGAAGTCGAAATGCCGGGGCTCATGGCTT
GCCGCGCCGAGTTCGGCCCTTCACAGCCCTTCAAAGGAGCCAAGATCACC
GGTTCACTCCACATGACCATCCAGACCGCCGTCCTCATCGAGACCCTCAC
CGCTCTCGGCGCCGAAGTCCGCTGGTGCTCCTGCAACATCTTCTCAACCC
AAGACCACGCGGCCGCCGCCATCGCACGTGACTCCGCCTCCGTCTTTGCC
TGGAAGGGTGAGACCCTCCAGGAGTACTGGTGGTGCACGGAGAAAGCCCT
GGACTGGGGTCCCGGCGGCGGCCCAGATCTCATCGTCGATGACGGTGGTG
ACGCCACGTTGTTGATCCACGAGGGAGTCAAAGCTGAGGAGATCTACGAG
AAGACCGGGAAGTTGCCCGACCCGGCCTCCACCGACAACGCCGAGTTTCA
GATTGTTTTGACTATCAT
back to top