FC931069

Overview
NameFC931069
Unique NameFC931069
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length668
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10254 contig Ccv1_Contig10254:1..670. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_RALEJ (Adenosylhomocysteinase OS=Ralstonia eutropha (strain JMP134) GN=ahcY PE=3 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 6.875e-44
Identity = 87/144 (60.42%), Postives = 105/144 (72.92%), Query Frame = 1
Query:  160 REFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE 591
            +++ V D+S A +GR EI +AE EMPGLMA R EF  +QP KGA+I GSLHMTIQTAVLIETL ALGA+VRW SCNIFSTQDH              +KGE+L+EYW  T +  DW  GG P++I+DDGGDATLL+H G KAE+
Sbjct:    9 QDYLVADISLAGWGRKEIAIAETEMPGLMAIRDEFAAAQPLKGARIAGSLHMTIQTAVLIETLKALGADVRWASCNIFSTQDHAAAAIAAGGTPVFAFKGESLKEYWDFTHRIFDWVDGGTPNMILDDGGDATLLLHLGAKAEK 152          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_METPP (Adenosylhomocysteinase OS=Methylibium petroleiphilum (strain PM1) GN=ahcY PE=3 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 6.875e-44
Identity = 92/156 (58.97%), Postives = 109/156 (69.87%), Query Frame = 1
Query:  136 SVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWG----PGGGPDLIVDDGGDATLLIHEGVKAEE 591
            +V K     +  V DLS AD+GR EI++AE EMPGLMA R EF  SQP KGA+ITGSLHMTIQTAVL+ETL ALGA+VRW SCNIFSTQDH              +KGETL +YW  T +  D+G     G GP++I+DDGGDATLL+H G KAE+
Sbjct:    3 AVLKPTPTHDHHVADLSLADWGRKEIKIAETEMPGLMAIRQEFAASQPLKGARITGSLHMTIQTAVLVETLQALGAQVRWASCNIFSTQDHAAAALVAAGTPVFAYKGETLTDYWDYTHRIFDFGAKGTDGEGPNMILDDGGDATLLMHLGQKAEK 158          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_SOLUE (Adenosylhomocysteinase OS=Solibacter usitatus (strain Ellin6076) GN=ahcY PE=3 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 8.979e-44
Identity = 86/145 (59.31%), Postives = 101/145 (69.66%), Query Frame = 1
Query:  154 SGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 588
            S   FKV DLS A++GR EI ++E EMPGLMA R ++   +P  G +ITGSLHMTIQTAVLIETL  LGA VRW SCNIFSTQDH              WKGE+L+EYWWCT +A+    G GP L+VDDGGD TLLIH+G + E
Sbjct:    9 SDATFKVADLSLAEWGRKEISVSEFEMPGLMAIRRKYAKEKPLAGVRITGSLHMTIQTAVLIETLVDLGASVRWASCNIFSTQDHAAAAIAKAGVPVFAWKGESLEEYWWCTLQAVTHPGGKGPQLVVDDGGDVTLLIHKGYELE 153          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_OCHA4 (Adenosylhomocysteinase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=ahcY PE=3 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 1.173e-43
Identity = 88/145 (60.69%), Postives = 105/145 (72.41%), Query Frame = 1
Query:  154 SGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 588
            + ++F VKDLS AD+GR E+++AE EMPGLMA R EFG SQP KGA+I+GSLHMTIQTAVLIETL ALGAEVRW SCNIFSTQDH               KGETL+EYW  T++   W  G   ++I+DDGGDAT+ I  G +AE
Sbjct:    3 ASQDFVVKDLSLADWGRKELDIAETEMPGLMAAREEFGKSQPLKGARISGSLHMTIQTAVLIETLQALGAEVRWASCNIFSTQDHAAAAIAATGTPVFAIKGETLEEYWTYTDQIFQWPDGEPSNMILDDGGDATMYILIGARAE 147          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_RALEH (Adenosylhomocysteinase OS=Ralstonia eutropha (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=ahcY PE=3 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 1.532e-43
Identity = 85/144 (59.03%), Postives = 105/144 (72.92%), Query Frame = 1
Query:  160 REFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE 591
            +++ V D++ A +GR EI +AE EMPGLMA R EF  +QP KGA+I GSLHMTIQTAVLIETL ALGA+VRW SCNIFSTQDH              +KGE+L+EYW  T +  DW  GG P++I+DDGGDATLL+H G +AE+
Sbjct:    9 QDYLVADINLAGWGRKEIAIAETEMPGLMAIRDEFAAAQPLKGARIAGSLHMTIQTAVLIETLKALGADVRWASCNIFSTQDHAAAAIAAGGTPVFAFKGESLKEYWDFTHRIFDWADGGTPNMILDDGGDATLLLHLGARAEK 152          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_CUPTR (Adenosylhomocysteinase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=ahcY PE=3 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 1.532e-43
Identity = 85/144 (59.03%), Postives = 105/144 (72.92%), Query Frame = 1
Query:  160 REFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE 591
            +++ V D++ A +GR EI +AE EMPGLMA R EF  +QP KGA+I GSLHMTIQTAVLIETL ALGA+VRW SCNIFSTQDH              +KGE+L+EYW  T +  DW  GG P++I+DDGGDATLL+H G +AE+
Sbjct:    9 QDYLVADINLAGWGRKEIAIAETEMPGLMAIRDEFAAAQPLKGARIAGSLHMTIQTAVLIETLKALGADVRWASCNIFSTQDHAAAAIAAGGTPVFAFKGESLKEYWDFTHRIFDWADGGTPNMILDDGGDATLLLHLGARAEK 152          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_SYNPW (Adenosylhomocysteinase OS=Synechococcus sp. (strain WH7803) GN=ahcY PE=3 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 2.000e-43
Identity = 83/144 (57.64%), Postives = 105/144 (72.92%), Query Frame = 1
Query:  160 REFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE 591
            +++ + D++QA+FGR E+++AE EMPGLMA R ++G  +P KGA+I GSLHMTIQTA LIETL  LGAEVRW SCNIFSTQDH               KGETL+EYW  T + L+WG GG P++I+DDGGDAT L+  G KAE+
Sbjct:   15 QDYVIADINQAEFGRKELDIAETEMPGLMALREKYGTEKPLKGARIAGSLHMTIQTACLIETLVELGAEVRWASCNIFSTQDHAAAAMAARDIPVFAVKGETLEEYWEYTHRILEWGDGGSPNMILDDGGDATGLVMLGSKAEQ 158          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_RHILW (Adenosylhomocysteinase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=ahcY PE=3 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 2.000e-43
Identity = 85/143 (59.44%), Postives = 103/143 (72.03%), Query Frame = 1
Query:  160 REFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 588
            +++ V D+  ADFGR EI +AE EMPGLM+CR EFG ++P KGA+ITGSLHMTIQTAVLIETL ALGAEVRW SCNIFSTQDH               KGE+L++YW  T+K   W  GG  ++I+DDGGDAT+ I  G +AE
Sbjct:    5 KDYVVADIGLADFGRKEITIAETEMPGLMSCRTEFGQAKPLKGARITGSLHMTIQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAIAAAGVPVFAIKGESLEDYWVYTDKIFQWADGGLSNMILDDGGDATMYILLGARAE 147          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_RHIL3 (Adenosylhomocysteinase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ahcY PE=3 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 2.000e-43
Identity = 85/143 (59.44%), Postives = 103/143 (72.03%), Query Frame = 1
Query:  160 REFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 588
            +++ V D+  ADFGR EI +AE EMPGLM+CR EFG ++P KGA+ITGSLHMTIQTAVLIETL ALGAEVRW SCNIFSTQDH               KGE+L++YW  T+K   W  GG  ++I+DDGGDAT+ I  G +AE
Sbjct:    5 KDYVVADIGLADFGRKEITIAETEMPGLMSCRTEFGQTKPLKGARITGSLHMTIQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAIAASGVPVFAIKGESLEDYWVYTDKIFQWADGGLSNMILDDGGDATMYILLGARAE 147          
BLAST of FC931069 vs. ExPASy Swiss-Prot
Match: SAHH_LEPBL (Adenosylhomocysteinase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=ahcY PE=3 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 2.000e-43
Identity = 88/147 (59.86%), Postives = 102/147 (69.39%), Query Frame = 1
Query:  133 LSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHE 573
            +S      G  +KVKDLSQA++GR EI LAE EMPGLMA R E+   +P  GA+I GSLHMTIQTAVLIETLT LGAEVRW SCNIFSTQDH              WKGET +EYWWC E+ L +G   GP++I+DDGGD T  +HE
Sbjct:    1 MSATTQEKGLNYKVKDLSQAEWGRQEIILAEKEMPGLMALRQEYKGKKPLAGARIAGSLHMTIQTAVLIETLTELGAEVRWSSCNIFSTQDHAAAAIAKAGVPVFAWKGETEEEYWWCIEQTLFFG-DKGPNMILDDGGDLTAYVHE 146          
The following BLAST results are available for this feature:
BLAST of FC931069 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 235
Match NameE-valueIdentityDescription
SAHH_RALEJ6.875e-4460.42Adenosylhomocysteinase OS=Ralstonia eutropha (stra... [more]
SAHH_METPP6.875e-4458.97Adenosylhomocysteinase OS=Methylibium petroleiphil... [more]
SAHH_SOLUE8.979e-4459.31Adenosylhomocysteinase OS=Solibacter usitatus (str... [more]
SAHH_OCHA41.173e-4360.69Adenosylhomocysteinase OS=Ochrobactrum anthropi (s... [more]
SAHH_RALEH1.532e-4359.03Adenosylhomocysteinase OS=Ralstonia eutropha (stra... [more]
SAHH_CUPTR1.532e-4359.03Adenosylhomocysteinase OS=Cupriavidus taiwanensis ... [more]
SAHH_SYNPW2.000e-4357.64Adenosylhomocysteinase OS=Synechococcus sp. (strai... [more]
SAHH_RHILW2.000e-4359.44Adenosylhomocysteinase OS=Rhizobium leguminosarum ... [more]
SAHH_RHIL32.000e-4359.44Adenosylhomocysteinase OS=Rhizobium leguminosarum ... [more]
SAHH_LEPBL2.000e-4359.86Adenosylhomocysteinase OS=Leptospira borgpeterseni... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101A12EF PostHarvP1 Citrus clementina cDNA clone C34101A12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931069 ID=FC931069|Name=FC931069|organism=Citrus clementina|type=EST|length=668bp
GGCTCACACCCACTCTATCTCTCTCGCTTGTACAATCATTCACTTTGTTT
GGTTGGTTTCCAAAGAGAGAGTAGAGTGCCCTCTCTTCCTTCTTCCTTTT
AGATCTATCAATTCTATTAATAAGCCATGGCTTTGTCCGTCCAGAAATCC
GCTAGCGGTCGTGAATTCAAGGTGAAGGATCTGTCCCAGGCTGACTTCGG
CCGCCTCGAAATCGAGTTGGCCGAAGTCGAAATGCCGGGGCTCATGGCTT
GCCGCGCCGAGTTCGGCCCTTCACAGCCCTTCAAAGGAGCCAAGATCACC
GGTTCACTCCACATGACCATCCAGACCGCCGTCCTCATCGAGACCCTCAC
CGCTCTCGGCGCCGAAGTCCGCTGGTGCTCCTGCAACATCTTCTCAACCC
AAGACCACGCGGCCGCCGCCATCGCACGTGACTCCGCCTCCGTCTTTGCC
TGGAAGGGTGAGACCCTCCAGGAGTACTGGTGGTGCACGGAGAAAGCCCT
GGACTGGGGTCCCGGCGGCGGCCCAGATCTCATCGTCGATGACGGTGGTG
ACGCCACGTTGTTGATCCACGAGGGAGTCAAAGCTGAGGAGATCTACGAG
AAGACCGGGAAGTTGCCCGACCCGGCCTCCACCGACAACGCCGAGTTTCA
GATTGTTTTGACTATCAT
back to top