FC931074

Overview
NameFC931074
Unique NameFC931074
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length560
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15265 contig Ccv1_Contig15265:1..560. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_SHESW (S-adenosylmethionine synthetase OS=Shewanella sp. (strain W3-18-1) GN=metK PE=3 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 7.270e-32
Identity = 68/107 (63.55%), Postives = 82/107 (76.64%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            M   LFTSESV+EGHPDK+ D++SDAVLDA LAQDP ++VACET  KT MV+V GE+TT A VD E++ R T R IG+T +D+G DAD C VL  I +QSPDI QGV
Sbjct:    1 MAKHLFTSESVSEGHPDKIADQISDAVLDAILAQDPKARVACETYVKTGMVLVGGEVTTSAWVDIEELTRKTVREIGYTHSDMGFDADSCAVLNAIGKQSPDINQGV 107          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_SHESH (S-adenosylmethionine synthetase OS=Shewanella sediminis (strain HAW-EB3) GN=metK PE=3 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 7.270e-32
Identity = 69/107 (64.49%), Postives = 81/107 (75.70%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            M   LFTSESV+EGHPDK+ D++SDAVLDA L QDP ++VACET  KT MVMV GE+TT A VD E+I R T R IG+T +D+G DAD C VL  I +QSPDI QGV
Sbjct:    1 MAKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVMVGGEVTTSAWVDIEEITRKTVREIGYTHSDMGFDADSCAVLNAIGKQSPDINQGV 107          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_SHEPC (S-adenosylmethionine synthetase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=metK PE=3 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 7.270e-32
Identity = 68/107 (63.55%), Postives = 82/107 (76.64%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            M   LFTSESV+EGHPDK+ D++SDAVLDA LAQDP ++VACET  KT MV+V GE+TT A VD E++ R T R IG+T +D+G DAD C VL  I +QSPDI QGV
Sbjct:    1 MAKHLFTSESVSEGHPDKIADQISDAVLDAILAQDPKARVACETYVKTGMVLVGGEVTTSAWVDIEELTRKTVREIGYTHSDMGFDADSCAVLNAIGKQSPDINQGV 107          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_CARHZ (S-adenosylmethionine synthetase OS=Carboxydothermus hydrogenoformans (strain Z-2901 / DSM 6008) GN=metK PE=3 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 7.270e-32
Identity = 66/114 (57.89%), Postives = 83/114 (72.81%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEI 555
            LFTSESV EGHPDK+ D++SDAVLDA LAQDP ++VACET   T +V+V GEITT   VD  K+VR+T R IG+T A  G D D C V+ +I++QSPDIA GV+  L  +  E+
Sbjct:    5 LFTSESVTEGHPDKIADQISDAVLDAILAQDPQARVACETAVTTGLVLVIGEITTSCYVDIPKVVRETIREIGYTRAKYGFDGDTCAVITSIDEQSPDIALGVNRALEAKTGEM 118          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_CALS8 (S-adenosylmethionine synthetase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903) GN=metK PE=3 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 7.270e-32
Identity = 65/103 (63.11%), Postives = 78/103 (75.73%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            LFTSESV EGHPDK+CD++SDAVLDA L +DP ++VACE    T +V+V GEITTK  VD  KI RDT R IG+T A  G DAD C V+ +I++QSPDIA GV
Sbjct:    4 LFTSESVTEGHPDKICDQISDAVLDAILEKDPYARVACEVAVTTGLVLVMGEITTKCYVDIPKIARDTIREIGYTRAKYGFDADTCAVITSIDEQSPDIAMGV 106          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_ANATD (S-adenosylmethionine synthetase OS=Anaerocellum thermophilum (strain DSM 6725 / Z-1320) GN=metK PE=3 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 7.270e-32
Identity = 65/103 (63.11%), Postives = 78/103 (75.73%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            LFTSESV EGHPDK+CD++SDAVLDA L +DP ++VACE    T +V+V GEITTK  VD  KI RDT R IG+T A  G DAD C V+ +I++QSPDIA GV
Sbjct:    4 LFTSESVTEGHPDKICDQISDAVLDAILEKDPYARVACEVAVTTGLVLVMGEITTKCYVDIPKIARDTIREIGYTRAKYGFDADTCAVITSIDEQSPDIAMGV 106          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_SHEPW (S-adenosylmethionine synthetase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=metK PE=3 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 9.495e-32
Identity = 68/107 (63.55%), Postives = 81/107 (75.70%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            M   LFTSESV+EGHPDK+ D++SDAVLDA L QDP ++VACET  KT MVMV GE+TT A VD E+I R T R IG+T +D+G DAD C +L  I +QSPDI QGV
Sbjct:    1 MAKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVMVGGEVTTSAWVDIEEITRKTVREIGYTHSDMGFDADSCAILNAIGKQSPDINQGV 107          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_SHEFN (S-adenosylmethionine synthetase OS=Shewanella frigidimarina (strain NCIMB 400) GN=metK PE=3 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 9.495e-32
Identity = 68/107 (63.55%), Postives = 82/107 (76.64%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            M   LFTSESV+EGHPDK+ D++SDAVLDA L QDP ++VACET  KT MV+V GE+TT A VD E+I R T R IG+T++D+G DAD C VL  I +QSPDI QGV
Sbjct:    1 MAKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEVTTSAWVDIEEITRKTVREIGYTNSDMGFDADSCAVLNAIGKQSPDINQGV 107          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_METFK (S-adenosylmethionine synthetase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=metK PE=3 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 9.495e-32
Identity = 65/108 (60.19%), Postives = 84/108 (77.78%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVH 525
            M  +LFTSESV+EGHPDK+ D++SD++LDA L QDP ++VA ET T T +V++ GEITT ANVDY KI RDT + IG+ +AD G+D   C VLV  ++QSPDIAQGV+
Sbjct:    1 MSEYLFTSESVSEGHPDKVADQISDSILDAILEQDPTARVAAETLTNTGLVVLAGEITTTANVDYIKIARDTIKRIGYDNADYGIDYKSCAVLVAYDKQSPDIAQGVN 108          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_LACSS (S-adenosylmethionine synthetase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=metK PE=3 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 9.495e-32
Identity = 63/116 (54.31%), Postives = 85/116 (73.28%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEE 552
            E  LFTSESV+EGHPDK+ D++SDA+LDA L QDP ++VACET   T +V+V GEI+T A VD +K+VR+T + IG+     G D D+C V+V +++QSPDIAQGV   L  R ++
Sbjct:    3 ERHLFTSESVSEGHPDKIADQISDAILDAMLEQDPQARVACETTVTTGLVLVVGEISTTAYVDIQKVVRETIKKIGYRDGQYGFDGDNCAVIVALDEQSPDIAQGVDDSLESREKD 118          
The following BLAST results are available for this feature:
BLAST of FC931074 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK_SHESW7.270e-3263.55S-adenosylmethionine synthetase OS=Shewanella sp. ... [more]
METK_SHESH7.270e-3264.49S-adenosylmethionine synthetase OS=Shewanella sedi... [more]
METK_SHEPC7.270e-3263.55S-adenosylmethionine synthetase OS=Shewanella putr... [more]
METK_CARHZ7.270e-3257.89S-adenosylmethionine synthetase OS=Carboxydothermu... [more]
METK_CALS87.270e-3263.11S-adenosylmethionine synthetase OS=Caldicellulosir... [more]
METK_ANATD7.270e-3263.11S-adenosylmethionine synthetase OS=Anaerocellum th... [more]
METK_SHEPW9.495e-3263.55S-adenosylmethionine synthetase OS=Shewanella piez... [more]
METK_SHEFN9.495e-3263.55S-adenosylmethionine synthetase OS=Shewanella frig... [more]
METK_METFK9.495e-3260.19S-adenosylmethionine synthetase OS=Methylobacillus... [more]
METK_LACSS9.495e-3254.31S-adenosylmethionine synthetase OS=Lactobacillus s... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B05EF PostHarvP1 Citrus clementina cDNA clone C34101B05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931074 ID=FC931074|Name=FC931074|organism=Citrus clementina|type=EST|length=560bp
GAAAAAAAACGAGAGAACTGCGAGTCGAGCTGCCGTTTTAGCGCCTCGCT
CGCTTCTCGCAGCGTATGCATATCGTGTTTCTCTCGGTCTTCTGGGTACT
GACCATTTTCGTATATCACCACCTTCAATTCCATTTGTACTCGCACCACG
GCCTCCTGCAAAGCGAAAGCTGCAGCTTCAGGTTAAATCAAATTAAAGAA
AATGGAAACATTTCTTTTCACATCAGAATCAGTGAACGAGGGTCACCCGG
ACAAGCTGTGTGACCGAGTTTCGGACGCAGTACTGGACGCGTGTTTGGCT
CAGGATCCTGACAGCAAAGTTGCTTGTGAAACATGCACAAAGACCAACAT
GGTCATGGTTTTTGGAGAAATTACAACCAAGGCCAATGTGGATTACGAGA
AAATCGTGCGTGATACATGCAGATCGATTGGGTTCACATCGGCCGATGTG
GGGCTTGATGCTGATCACTGCAAAGTTCTTGTTAATATTGAGCAGCAGAG
CCCTGACATTGCTCAGGGTGTTCATGGGCATCTCACAAAGCGGCCTGAGG
AGATTGGTGC
back to top