FC931074

Overview
NameFC931074
Unique NameFC931074
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length560
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15265 contig Ccv1_Contig15265:1..560. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_CLOTE (S-adenosylmethionine synthetase OS=Clostridium tetani GN=metK PE=3 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 2.115e-31
Identity = 66/110 (60.00%), Postives = 80/110 (72.73%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKR 543
            LFTSESV EGHPDK+CD++SDAVLDA L +DP+ +VACET   T MV+V GEITT   VD  KIVR+T  +IG+T A  G D+D C VL +I +QSPDIA GV   L  +
Sbjct:    4 LFTSESVTEGHPDKICDQISDAVLDAILERDPNGRVACETSVTTGMVLVTGEITTNCYVDIPKIVRNTIEAIGYTRAKYGFDSDTCAVLTSISEQSPDIAMGVDESLESK 113          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_CLOPH (S-adenosylmethionine synthetase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=metK PE=3 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 2.115e-31
Identity = 67/114 (58.77%), Postives = 82/114 (71.93%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEI 555
            LFTSESV EGHPDK+CD++SDAVLDA L QDP S+VACET   T +V+V GEITT   VD +KIVRDT + IG+  A  G DAD C V+V +++QS DIA GV   L  +  E+
Sbjct:    6 LFTSESVTEGHPDKICDQISDAVLDALLEQDPMSRVACETAITTGLVLVMGEITTSGYVDIQKIVRDTVKEIGYDRAKYGFDADTCGVIVALDEQSKDIALGVDKALEAKQNEM 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_VIBHB (S-adenosylmethionine synthetase OS=Vibrio harveyi (strain ATCC BAA-1116 / BB120) GN=metK PE=3 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 2.763e-31
Identity = 67/107 (62.62%), Postives = 81/107 (75.70%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            M   LFTSESV+EGHPDK+ D++SDAVLDA L QDP ++VACET  KT MVMV GE+TT A VD E+I R+T R IG+  +D+G DA+ C VL  I +QSPDI QGV
Sbjct:    1 MAKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVMVGGEVTTSAWVDIEEITRETVREIGYVHSDMGFDANSCAVLNTIGKQSPDINQGV 107          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_VIBFM (S-adenosylmethionine synthetase OS=Vibrio fischeri (strain MJ11) GN=metK PE=3 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 2.763e-31
Identity = 67/107 (62.62%), Postives = 81/107 (75.70%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            M   LFTSESV+EGHPDK+ D++SDAVLDA L QDP ++VACET  KT MVMV GE+TT A VD E+I R+T R IG+  +D+G DA+ C VL  I +QSPDI QGV
Sbjct:    1 MAKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVMVGGEVTTSAWVDIEEITRETVREIGYVHSDMGFDANSCAVLNTIGKQSPDINQGV 107          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_VIBF1 (S-adenosylmethionine synthetase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=metK PE=3 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 2.763e-31
Identity = 67/107 (62.62%), Postives = 81/107 (75.70%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            M   LFTSESV+EGHPDK+ D++SDAVLDA L QDP ++VACET  KT MVMV GE+TT A VD E+I R+T R IG+  +D+G DA+ C VL  I +QSPDI QGV
Sbjct:    1 MAKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVMVGGEVTTSAWVDIEEITRETVREIGYVHSDMGFDANSCAVLNTIGKQSPDINQGV 107          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_SHESR (S-adenosylmethionine synthetase OS=Shewanella sp. (strain MR-7) GN=metK PE=3 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 2.763e-31
Identity = 67/107 (62.62%), Postives = 81/107 (75.70%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            M   LFTSESV+EGHPDK+ D++SDAVLDA LAQDP ++VACET  KT MV+V GE+TT A VD E++ R T R IG+  +D+G DAD C VL  I +QSPDI QGV
Sbjct:    1 MAKHLFTSESVSEGHPDKIADQISDAVLDAILAQDPKARVACETYVKTGMVLVGGEVTTSAWVDIEELTRKTVREIGYVHSDMGFDADSCAVLNAIGKQSPDINQGV 107          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_SHESM (S-adenosylmethionine synthetase OS=Shewanella sp. (strain MR-4) GN=metK PE=3 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 2.763e-31
Identity = 67/107 (62.62%), Postives = 81/107 (75.70%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            M   LFTSESV+EGHPDK+ D++SDAVLDA LAQDP ++VACET  KT MV+V GE+TT A VD E++ R T R IG+  +D+G DAD C VL  I +QSPDI QGV
Sbjct:    1 MAKHLFTSESVSEGHPDKIADQISDAVLDAILAQDPKARVACETYVKTGMVLVGGEVTTSAWVDIEELTRKTVREIGYVHSDMGFDADSCAVLNAIGKQSPDINQGV 107          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_SHESA (S-adenosylmethionine synthetase OS=Shewanella sp. (strain ANA-3) GN=metK PE=3 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 2.763e-31
Identity = 67/107 (62.62%), Postives = 81/107 (75.70%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            M   LFTSESV+EGHPDK+ D++SDAVLDA LAQDP ++VACET  KT MV+V GE+TT A VD E++ R T R IG+  +D+G DAD C VL  I +QSPDI QGV
Sbjct:    1 MAKHLFTSESVSEGHPDKIADQISDAVLDAILAQDPKARVACETYVKTGMVLVGGEVTTSAWVDIEELTRKTVREIGYVHSDMGFDADSCAVLNAIGKQSPDINQGV 107          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_SHEAM (S-adenosylmethionine synthetase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=metK PE=3 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 2.763e-31
Identity = 68/107 (63.55%), Postives = 80/107 (74.77%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            M   LFTSESV+EGHPDK+ D++SDAVLDA L QDP ++VACET  KT MVMV GEITT A VD E++ R T R IG+  +D+G DAD C VL  I +QSPDI QGV
Sbjct:    1 MAKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVMVGGEITTSAWVDIEELTRKTVREIGYVHSDMGFDADSCAVLSAIGKQSPDINQGV 107          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_LEGPH (S-adenosylmethionine synthetase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=metK PE=3 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 2.763e-31
Identity = 66/112 (58.93%), Postives = 83/112 (74.11%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTK 540
            E ++FTSESV+EGHPDK+ D++SDA+LDA LAQDP ++VACE   KT MV+V GEITTKA VD E+I R   + IG+ S+ +G D + C VL  I +QSPDIAQGV    TK
Sbjct:    3 EVYVFTSESVSEGHPDKIADQISDAILDAILAQDPKARVACEVLVKTGMVLVGGEITTKAWVDVEEITRHVIKDIGYNSSQMGFDWESCAVLSAIGKQSPDIAQGVDNQQTK 114          
The following BLAST results are available for this feature:
BLAST of FC931074 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK_CLOTE2.115e-3160.00S-adenosylmethionine synthetase OS=Clostridium tet... [more]
METK_CLOPH2.115e-3158.77S-adenosylmethionine synthetase OS=Clostridium phy... [more]
METK_VIBHB2.763e-3162.62S-adenosylmethionine synthetase OS=Vibrio harveyi ... [more]
METK_VIBFM2.763e-3162.62S-adenosylmethionine synthetase OS=Vibrio fischeri... [more]
METK_VIBF12.763e-3162.62S-adenosylmethionine synthetase OS=Vibrio fischeri... [more]
METK_SHESR2.763e-3162.62S-adenosylmethionine synthetase OS=Shewanella sp. ... [more]
METK_SHESM2.763e-3162.62S-adenosylmethionine synthetase OS=Shewanella sp. ... [more]
METK_SHESA2.763e-3162.62S-adenosylmethionine synthetase OS=Shewanella sp. ... [more]
METK_SHEAM2.763e-3163.55S-adenosylmethionine synthetase OS=Shewanella amaz... [more]
METK_LEGPH2.763e-3158.93S-adenosylmethionine synthetase OS=Legionella pneu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B05EF PostHarvP1 Citrus clementina cDNA clone C34101B05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931074 ID=FC931074|Name=FC931074|organism=Citrus clementina|type=EST|length=560bp
GAAAAAAAACGAGAGAACTGCGAGTCGAGCTGCCGTTTTAGCGCCTCGCT
CGCTTCTCGCAGCGTATGCATATCGTGTTTCTCTCGGTCTTCTGGGTACT
GACCATTTTCGTATATCACCACCTTCAATTCCATTTGTACTCGCACCACG
GCCTCCTGCAAAGCGAAAGCTGCAGCTTCAGGTTAAATCAAATTAAAGAA
AATGGAAACATTTCTTTTCACATCAGAATCAGTGAACGAGGGTCACCCGG
ACAAGCTGTGTGACCGAGTTTCGGACGCAGTACTGGACGCGTGTTTGGCT
CAGGATCCTGACAGCAAAGTTGCTTGTGAAACATGCACAAAGACCAACAT
GGTCATGGTTTTTGGAGAAATTACAACCAAGGCCAATGTGGATTACGAGA
AAATCGTGCGTGATACATGCAGATCGATTGGGTTCACATCGGCCGATGTG
GGGCTTGATGCTGATCACTGCAAAGTTCTTGTTAATATTGAGCAGCAGAG
CCCTGACATTGCTCAGGGTGTTCATGGGCATCTCACAAAGCGGCCTGAGG
AGATTGGTGC
back to top