FC931074

Overview
NameFC931074
Unique NameFC931074
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length560
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15265 contig Ccv1_Contig15265:1..560. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_LEGPC (S-adenosylmethionine synthetase OS=Legionella pneumophila (strain Corby) GN=metK PE=3 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 2.763e-31
Identity = 66/112 (58.93%), Postives = 83/112 (74.11%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTK 540
            E ++FTSESV+EGHPDK+ D++SDA+LDA LAQDP ++VACE   KT MV+V GEITTKA VD E+I R   + IG+ S+ +G D + C VL  I +QSPDIAQGV    TK
Sbjct:    3 EVYVFTSESVSEGHPDKIADQISDAILDAILAQDPKARVACEVLVKTGMVLVGGEITTKAWVDVEEITRHVIKDIGYNSSQMGFDWESCAVLSAIGKQSPDIAQGVDNQQTK 114          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_LEGPA (S-adenosylmethionine synthetase OS=Legionella pneumophila (strain Paris) GN=metK PE=3 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 2.763e-31
Identity = 66/112 (58.93%), Postives = 83/112 (74.11%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTK 540
            E ++FTSESV+EGHPDK+ D++SDA+LDA LAQDP ++VACE   KT MV+V GEITTKA VD E+I R   + IG+ S+ +G D + C VL  I +QSPDIAQGV    TK
Sbjct:    3 EVYVFTSESVSEGHPDKIADQISDAILDAILAQDPKARVACEVLVKTGMVLVGGEITTKAWVDVEEITRHVIKDIGYNSSQMGFDWESCAVLSAIGKQSPDIAQGVDNQQTK 114          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_ALISL (S-adenosylmethionine synthetase OS=Aliivibrio salmonicida (strain LFI1238) GN=metK PE=3 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 2.763e-31
Identity = 67/107 (62.62%), Postives = 81/107 (75.70%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            M   LFTSESV+EGHPDK+ D++SDAVLDA L QDP ++VACET  KT MVMV GE+TT A VD E+I R+T R IG+  +D+G DA+ C VL  I +QSPDI QGV
Sbjct:    1 MAKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVMVGGEVTTSAWVDIEEITRETVREIGYVHSDMGFDANSCAVLNTIGKQSPDINQGV 107          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_VIBVY (S-adenosylmethionine synthetase OS=Vibrio vulnificus (strain YJ016) GN=metK PE=3 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 3.608e-31
Identity = 67/107 (62.62%), Postives = 81/107 (75.70%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            M   LFTSESV+EGHPDK+ D++SDAVLDA L QDP ++VACET  KT MVMV GEITT A VD E++ R+T R IG+  +D+G DA+ C VL  I +QSPDI QGV
Sbjct:    1 MAKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVMVGGEITTSAWVDIEELTRETVREIGYVHSDMGFDANSCAVLNTIGKQSPDINQGV 107          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_VIBVU (S-adenosylmethionine synthetase OS=Vibrio vulnificus GN=metK PE=3 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 3.608e-31
Identity = 67/107 (62.62%), Postives = 81/107 (75.70%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            M   LFTSESV+EGHPDK+ D++SDAVLDA L QDP ++VACET  KT MVMV GEITT A VD E++ R+T R IG+  +D+G DA+ C VL  I +QSPDI QGV
Sbjct:    1 MAKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVMVGGEITTSAWVDIEELTRETVREIGYVHSDMGFDANSCAVLNTIGKQSPDINQGV 107          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_VIBPA (S-adenosylmethionine synthetase OS=Vibrio parahaemolyticus GN=metK PE=3 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 3.608e-31
Identity = 67/107 (62.62%), Postives = 81/107 (75.70%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            M   LFTSESV+EGHPDK+ D++SDAVLDA L QDP ++VACET  KT MVMV GEITT A VD E++ R+T R IG+  +D+G DA+ C VL  I +QSPDI QGV
Sbjct:    1 MAKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVMVGGEITTSAWVDIEELTRETVREIGYVHSDMGFDANSCAVLNTIGKQSPDINQGV 107          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_THETN (S-adenosylmethionine synthetase OS=Thermoanaerobacter tengcongensis GN=metK PE=3 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 3.608e-31
Identity = 64/114 (56.14%), Postives = 82/114 (71.93%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEI 555
            LFTSESV EGHPDK+CD++SDA+LD  L +DP ++VACET   T +V+V GEITT+  VD  +I RD  R IG+T A  G DAD C V+ +I++QSPDIA GV+  L  R  E+
Sbjct:    4 LFTSESVTEGHPDKICDQISDAILDEILKKDPYARVACETAVTTGLVLVMGEITTECYVDIPRIARDVIRDIGYTRAKYGFDADTCAVITSIDEQSPDIAMGVNKALEARRGEL 117          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_SHEON (S-adenosylmethionine synthetase OS=Shewanella oneidensis GN=metK PE=3 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 3.608e-31
Identity = 67/107 (62.62%), Postives = 81/107 (75.70%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            M   LFTSESV+EGHPDK+ D++SDAVLDA LAQDP ++VACET  KT MV+V GE+TT A VD E++ R T R IG+  +D+G DAD C VL  I +QSPDI QGV
Sbjct:    1 MAKHLFTSESVSEGHPDKIADQISDAVLDAILAQDPKARVACETYVKTGMVLVGGEVTTSAWVDIEELTRKTVREIGYIHSDMGFDADSCAVLNAIGKQSPDINQGV 107          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_NITEC (S-adenosylmethionine synthetase OS=Nitrosomonas eutropha (strain C91) GN=metK PE=3 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 3.608e-31
Identity = 62/108 (57.41%), Postives = 81/108 (75.00%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVH 525
            M  +LFTSESV+EGHPDK+ D++SDA+LDA L QDP ++VACET   T ++++ GEITT A +DY  I RDT R IG+TS+++G DA  C VL    +QSPDIA GV+
Sbjct:    1 MSNYLFTSESVSEGHPDKVADQISDAILDAILQQDPHARVACETMCSTGLIVLSGEITTHATIDYNVIPRDTVREIGYTSSEIGFDASTCAVLTAFNKQSPDIALGVN 108          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_MESFL (S-adenosylmethionine synthetase OS=Mesoplasma florum GN=metK PE=3 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 3.608e-31
Identity = 61/103 (59.22%), Postives = 81/103 (78.64%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            LFTSESV+EGHPDK+CD++SDA+LD  L QDP++KVACET   TN +++ G+ITT A+VDYEKI RD  R IG+ +   G++AD CK+ + +EQQS DIA G+
Sbjct:    4 LFTSESVSEGHPDKICDQISDAILDEVLKQDPNAKVACETFATTNYLLIGGQITTTASVDYEKIARDVLRKIGYNNDAYGINADTCKIDIRVEQQSADIALGI 106          
The following BLAST results are available for this feature:
BLAST of FC931074 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK_LEGPC2.763e-3158.93S-adenosylmethionine synthetase OS=Legionella pneu... [more]
METK_LEGPA2.763e-3158.93S-adenosylmethionine synthetase OS=Legionella pneu... [more]
METK_ALISL2.763e-3162.62S-adenosylmethionine synthetase OS=Aliivibrio salm... [more]
METK_VIBVY3.608e-3162.62S-adenosylmethionine synthetase OS=Vibrio vulnific... [more]
METK_VIBVU3.608e-3162.62S-adenosylmethionine synthetase OS=Vibrio vulnific... [more]
METK_VIBPA3.608e-3162.62S-adenosylmethionine synthetase OS=Vibrio parahaem... [more]
METK_THETN3.608e-3156.14S-adenosylmethionine synthetase OS=Thermoanaerobac... [more]
METK_SHEON3.608e-3162.62S-adenosylmethionine synthetase OS=Shewanella onei... [more]
METK_NITEC3.608e-3157.41S-adenosylmethionine synthetase OS=Nitrosomonas eu... [more]
METK_MESFL3.608e-3159.22S-adenosylmethionine synthetase OS=Mesoplasma flor... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B05EF PostHarvP1 Citrus clementina cDNA clone C34101B05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931074 ID=FC931074|Name=FC931074|organism=Citrus clementina|type=EST|length=560bp
GAAAAAAAACGAGAGAACTGCGAGTCGAGCTGCCGTTTTAGCGCCTCGCT
CGCTTCTCGCAGCGTATGCATATCGTGTTTCTCTCGGTCTTCTGGGTACT
GACCATTTTCGTATATCACCACCTTCAATTCCATTTGTACTCGCACCACG
GCCTCCTGCAAAGCGAAAGCTGCAGCTTCAGGTTAAATCAAATTAAAGAA
AATGGAAACATTTCTTTTCACATCAGAATCAGTGAACGAGGGTCACCCGG
ACAAGCTGTGTGACCGAGTTTCGGACGCAGTACTGGACGCGTGTTTGGCT
CAGGATCCTGACAGCAAAGTTGCTTGTGAAACATGCACAAAGACCAACAT
GGTCATGGTTTTTGGAGAAATTACAACCAAGGCCAATGTGGATTACGAGA
AAATCGTGCGTGATACATGCAGATCGATTGGGTTCACATCGGCCGATGTG
GGGCTTGATGCTGATCACTGCAAAGTTCTTGTTAATATTGAGCAGCAGAG
CCCTGACATTGCTCAGGGTGTTCATGGGCATCTCACAAAGCGGCCTGAGG
AGATTGGTGC
back to top