FC931074

Overview
NameFC931074
Unique NameFC931074
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length560
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15265 contig Ccv1_Contig15265:1..560. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_MUSAC (S-adenosylmethionine synthetase OS=Musa acuminata GN=METK PE=2 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 9.735e-61
Identity = 109/118 (92.37%), Postives = 113/118 (95.76%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            +TFLFTSESVNEGHPDKLCD++SDAVLDACL QDPDSKVACETCTKTNMVMVFGEITTK N+DYEKIVRDTCR IGFTS DVGLDADHCKVLVNIEQQSPDIAQGVHGH TKRPEEIG
Sbjct:    3 DTFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKGNIDYEKIVRDTCRDIGFTSEDVGLDADHCKVLVNIEQQSPDIAQGVHGHFTKRPEEIG 120          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK2_SOLLC (S-adenosylmethionine synthetase 2 OS=Solanum lycopersicum GN=SAM2 PE=2 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 9.735e-61
Identity = 110/119 (92.44%), Postives = 116/119 (97.48%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            METFLFTSESVNEGHPDKLCD+VSDAVLDACLAQDP+SKVACETCTKTN+VMVFGEITTKAN+DYEKIVRDTCR IGF S DVGLDAD+C+VLVNIEQQSPDIAQGVHGHLTKRPEEIG
Sbjct:    1 METFLFTSESVNEGHPDKLCDQVSDAVLDACLAQDPESKVACETCTKTNLVMVFGEITTKANIDYEKIVRDTCREIGFVSPDVGLDADNCRVLVNIEQQSPDIAQGVHGHLTKRPEEIG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK2_HORVU (S-adenosylmethionine synthetase 2 OS=Hordeum vulgare GN=SAM2 PE=2 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 9.735e-61
Identity = 111/118 (94.07%), Postives = 113/118 (95.76%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            ETFLFTSESVNEGHPDKLCD+VSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADHCKVLVNIEQQSPDIAQGVHGH TKRPEE+G
Sbjct:    4 ETFLFTSESVNEGHPDKLCDQVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRDIGFISDDVGLDADHCKVLVNIEQQSPDIAQGVHGHFTKRPEEVG 121          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK2_CATRO (S-adenosylmethionine synthetase 2 OS=Catharanthus roseus GN=SAMS2 PE=1 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 9.735e-61
Identity = 111/119 (93.28%), Postives = 116/119 (97.48%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            METFLFTSESVNEGHPDKLCD++SDAVLDACLAQDP+SKVACETCTKTNMVMVFGEITTKA VDYEKIVRDTCR+IGF S DVGLDAD+CKVLVNIEQQSPDIAQGVHGHLTKRPEEIG
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPESKVACETCTKTNMVMVFGEITTKAQVDYEKIVRDTCRAIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK1_HORVU (S-adenosylmethionine synthetase 1 OS=Hordeum vulgare GN=SAM1 PE=2 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 9.735e-61
Identity = 111/118 (94.07%), Postives = 113/118 (95.76%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            ETFLFTSESVNEGHPDKLCD+VSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKA VDYEKIVRDTCR IGF S DVGLDADHCKVLVNIEQQSPDIAQGVHGH TKRPEE+G
Sbjct:    4 ETFLFTSESVNEGHPDKLCDQVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRDIGFISDDVGLDADHCKVLVNIEQQSPDIAQGVHGHFTKRPEEVG 121          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK3_SOLLC (S-adenosylmethionine synthetase 3 OS=Solanum lycopersicum GN=SAM3 PE=2 SV=1)

HSP 1 Score: 231.491 bits (589), Expect = 2.169e-60
Identity = 110/119 (92.44%), Postives = 115/119 (96.64%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            METFLFTSESVNEGHPDKLCD+VSDA+LDACL QDP+SKVACETCTKTNMVMVFGEITTKA VDYEKIVRDTCR IGF SADVGLDAD+CKVLVNIEQQSPDIAQGVHGHLTK+PEEIG
Sbjct:    1 METFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRGIGFVSADVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKKPEEIG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK1_PICSI (S-adenosylmethionine synthetase 1 OS=Picea sitchensis GN=METK1 PE=2 SV=1)

HSP 1 Score: 231.491 bits (589), Expect = 2.169e-60
Identity = 107/119 (89.92%), Postives = 116/119 (97.48%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            M+TFLFTSESVNEGHPDKLCD++SDA+LDACL QDP+SKVACETCTKTNMVM+FGEITTKAN+DYEKIVRDTCR IGF SADVGLDAD+CKVLVNIEQQSPDIAQGVHGHLTK+PEEIG
Sbjct:    1 MDTFLFTSESVNEGHPDKLCDQISDAILDACLEQDPESKVACETCTKTNMVMIFGEITTKANIDYEKIVRDTCRGIGFVSADVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKKPEEIG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK2_SOLTU (S-adenosylmethionine synthetase 2 OS=Solanum tuberosum GN=METK2 PE=2 SV=1)

HSP 1 Score: 231.106 bits (588), Expect = 2.832e-60
Identity = 110/119 (92.44%), Postives = 115/119 (96.64%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            METFL TSESVNEGHPDKLCD+VSDA+LDACL QDP+SKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCR IGF SADVGLDAD+CKVLVNIEQQSPDIAQGVHGHLTK+PEEIG
Sbjct:    1 METFLLTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCREIGFISADVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKKPEEIG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_PINBN (S-adenosylmethionine synthetase OS=Pinus banksiana GN=METK PE=2 SV=1)

HSP 1 Score: 230.72 bits (587), Expect = 3.699e-60
Identity = 110/119 (92.44%), Postives = 114/119 (95.80%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            METFLFTSESVNEGHPDKLCD++SDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKA+VDYE+IVR TCR IGF S DVGLDADHCKVLVNIEQQSPDIAQGVHGH TKRPEEIG
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKADVDYEQIVRKTCREIGFISDDVGLDADHCKVLVNIEQQSPDIAQGVHGHFTKRPEEIG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK5_POPTR (S-adenosylmethionine synthetase 5 OS=Populus trichocarpa GN=METK5 PE=2 SV=1)

HSP 1 Score: 230.72 bits (587), Expect = 3.699e-60
Identity = 110/118 (93.22%), Postives = 116/118 (98.31%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            ETFLFTSESVNEGHPDKLCD++SDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKA+VDYEKIVRDTCR+IGFTSADVGLDAD+CKVLVNIEQQS DIAQGVHGH +KRPEEIG
Sbjct:    3 ETFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKADVDYEKIVRDTCRNIGFTSADVGLDADNCKVLVNIEQQSSDIAQGVHGHFSKRPEEIG 120          
The following BLAST results are available for this feature:
BLAST of FC931074 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK_MUSAC9.735e-6192.37S-adenosylmethionine synthetase OS=Musa acuminata ... [more]
METK2_SOLLC9.735e-6192.44S-adenosylmethionine synthetase 2 OS=Solanum lycop... [more]
METK2_HORVU9.735e-6194.07S-adenosylmethionine synthetase 2 OS=Hordeum vulga... [more]
METK2_CATRO9.735e-6193.28S-adenosylmethionine synthetase 2 OS=Catharanthus ... [more]
METK1_HORVU9.735e-6194.07S-adenosylmethionine synthetase 1 OS=Hordeum vulga... [more]
METK3_SOLLC2.169e-6092.44S-adenosylmethionine synthetase 3 OS=Solanum lycop... [more]
METK1_PICSI2.169e-6089.92S-adenosylmethionine synthetase 1 OS=Picea sitchen... [more]
METK2_SOLTU2.832e-6092.44S-adenosylmethionine synthetase 2 OS=Solanum tuber... [more]
METK_PINBN3.699e-6092.44S-adenosylmethionine synthetase OS=Pinus banksiana... [more]
METK5_POPTR3.699e-6093.22S-adenosylmethionine synthetase 5 OS=Populus trich... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B05EF PostHarvP1 Citrus clementina cDNA clone C34101B05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931074 ID=FC931074|Name=FC931074|organism=Citrus clementina|type=EST|length=560bp
GAAAAAAAACGAGAGAACTGCGAGTCGAGCTGCCGTTTTAGCGCCTCGCT
CGCTTCTCGCAGCGTATGCATATCGTGTTTCTCTCGGTCTTCTGGGTACT
GACCATTTTCGTATATCACCACCTTCAATTCCATTTGTACTCGCACCACG
GCCTCCTGCAAAGCGAAAGCTGCAGCTTCAGGTTAAATCAAATTAAAGAA
AATGGAAACATTTCTTTTCACATCAGAATCAGTGAACGAGGGTCACCCGG
ACAAGCTGTGTGACCGAGTTTCGGACGCAGTACTGGACGCGTGTTTGGCT
CAGGATCCTGACAGCAAAGTTGCTTGTGAAACATGCACAAAGACCAACAT
GGTCATGGTTTTTGGAGAAATTACAACCAAGGCCAATGTGGATTACGAGA
AAATCGTGCGTGATACATGCAGATCGATTGGGTTCACATCGGCCGATGTG
GGGCTTGATGCTGATCACTGCAAAGTTCTTGTTAATATTGAGCAGCAGAG
CCCTGACATTGCTCAGGGTGTTCATGGGCATCTCACAAAGCGGCCTGAGG
AGATTGGTGC
back to top