FC931074

Overview
NameFC931074
Unique NameFC931074
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length560
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15265 contig Ccv1_Contig15265:1..560. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_STREM (S-adenosylmethionine synthetase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=metK PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.676e-28
Identity = 63/113 (55.75%), Postives = 81/113 (71.68%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKR 543
            E  LFTSESV+EGHPDK+ D++SDA+LDA LA+DP++ VA ETC  T  V VFGEI+T A VD  ++VRDT   IG+T A+ G  A+   V  ++ +QSPDIAQGV+  L  R
Sbjct:    3 ERKLFTSESVSEGHPDKIADQISDAILDAILAKDPEAHVAAETCVYTGSVHVFGEISTTAYVDINRVVRDTIAEIGYTEAEYGFSAESVGVHPSLVEQSPDIAQGVNEALEAR 115          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_STRE4 (S-adenosylmethionine synthetase OS=Streptococcus equi subsp. equi (strain 4047) GN=metK PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.676e-28
Identity = 63/113 (55.75%), Postives = 81/113 (71.68%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKR 543
            E  LFTSESV+EGHPDK+ D++SDA+LDA LA+DP++ VA ETC  T  V VFGEI+T A VD  ++VRDT   IG+T A+ G  A+   V  ++ +QSPDIAQGV+  L  R
Sbjct:    3 ERKLFTSESVSEGHPDKIADQISDAILDAILAKDPEAHVAAETCVYTGSVHVFGEISTTAYVDINRVVRDTIAEIGYTEAEYGFSAESVGVHPSLVEQSPDIAQGVNEALEAR 115          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_PSYWF (S-adenosylmethionine synthetase OS=Psychrobacter sp. (strain PRwf-1) GN=metK PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.676e-28
Identity = 59/103 (57.28%), Postives = 80/103 (77.67%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            LFTSESV+EGHPDK+ D++SDA+LDA + +D  ++VACET  KT  V++ GEI+T AN+D E+IVRDT  SIG+  +D+G D + C V+  I +QSP+IAQGV
Sbjct:    6 LFTSESVSEGHPDKMADQISDALLDAIMREDLHARVACETLVKTGAVVLAGEISTTANIDIERIVRDTVNSIGYNHSDLGFDGETCAVINMIGKQSPEIAQGV 108          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_PROM4 (S-adenosylmethionine synthetase OS=Prochlorococcus marinus (strain MIT 9211) GN=metK PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.676e-28
Identity = 59/108 (54.63%), Postives = 78/108 (72.22%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADV-GLDADHCKVLVNIEQQSPDIAQGV 522
            M  F+FTSESV EGHPDK+CD++SDAVLDA L QDP S+VACE    T + ++ GE+T+ A VD+  +VR   + IG+  A   G DA+ C VLV +++QSPDIA+GV
Sbjct:    1 MSQFVFTSESVTEGHPDKICDQISDAVLDALLTQDPHSRVACEAVVNTGLCLITGEVTSTAEVDFINLVRSVIKEIGYKDAQAGGFDANSCAVLVALDKQSPDIAKGV 108          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_POLSJ (S-adenosylmethionine synthetase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=metK PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.676e-28
Identity = 60/104 (57.69%), Postives = 79/104 (75.96%), Query Frame = 1
Query:  211 FLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            FLFTSESV+EGHPDK+ D++SDA+LDA   QDP S+VA ET T T +V++ GEITT A+VDY ++ RDT + IG+ + + G+D   C VLV  ++QS DIAQGV
Sbjct:    5 FLFTSESVSEGHPDKVADQISDAILDAIFKQDPRSRVAAETLTNTGLVVLAGEITTNAHVDYIQVARDTIKRIGYDNTEYGIDYKGCAVLVAYDKQSNDIAQGV 108          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_LEPCP (S-adenosylmethionine synthetase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=metK PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.676e-28
Identity = 60/104 (57.69%), Postives = 79/104 (75.96%), Query Frame = 1
Query:  211 FLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            FLFTSESV+EGHPDK+ D++SDA+LDA   QDP S+VA ET T T +V++ GEITT A+VDY ++ RDT + IG+ + + G+D   C VLV  ++QS DIAQGV
Sbjct:    5 FLFTSESVSEGHPDKVADQISDAILDAIFEQDPRSRVAAETLTNTGLVVLAGEITTNAHVDYIQVARDTIKRIGYDNTEYGIDYKGCAVLVAYDKQSNDIAQGV 108          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_IDILO (S-adenosylmethionine synthetase OS=Idiomarina loihiensis GN=metK PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.676e-28
Identity = 67/119 (56.30%), Postives = 82/119 (68.91%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            M   LFTSESV+EGHPDK+ D++SDAVLDA LA+DP ++VACET  KT MV+V GEI+TKA VD E + R T + IG+  +D+G D   C VL  I +QS DI QGV       PEE G
Sbjct:    1 MSRHLFTSESVSEGHPDKIADQISDAVLDAILAKDPKARVACETYVKTGMVLVGGEISTKAWVDVEDLARQTVKDIGYRHSDMGFDGASCAVLNAIGKQSGDINQGVD---RANPEEQG 116          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_BAUCH (S-adenosylmethionine synthetase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=metK PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.676e-28
Identity = 61/108 (56.48%), Postives = 82/108 (75.93%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVH 525
            M   LFTSESV+EGHPDK+ D++SD VLDA LAQD  ++VACET  KT MV+V GEITT A +D E++ R+T R IG+T++++  DA+ C VL  I +QSPDI +G++
Sbjct:    1 MAKHLFTSESVSEGHPDKIADQISDTVLDAILAQDLKARVACETYVKTGMVLVGGEITTNAWIDIEELTRNTIRDIGYTNSEMKFDANSCAVLSIISKQSPDINKGIN 108          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_ACISJ (S-adenosylmethionine synthetase OS=Acidovorax sp. (strain JS42) GN=metK PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.676e-28
Identity = 60/104 (57.69%), Postives = 79/104 (75.96%), Query Frame = 1
Query:  211 FLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            FLFTSESV+EGHPDK+ D++SDA+LDA   QDP S+VA ET T T +V++ GEITT A+VDY ++ RDT + IG+ + + G+D   C VLV  ++QS DIAQGV
Sbjct:    5 FLFTSESVSEGHPDKVADQISDAILDAIFTQDPRSRVAAETLTNTGLVVLAGEITTNAHVDYIQVARDTIQRIGYDNTEYGIDYKGCAVLVAYDKQSNDIAQGV 108          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_ACIBY (S-adenosylmethionine synthetase OS=Acinetobacter baumannii (strain AYE) GN=metK PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.676e-28
Identity = 62/118 (52.54%), Postives = 84/118 (71.19%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            E  +FTSESV+EGHPDK+ D++SDA+LDA L +DP ++VACET  KT  V++ GEITT AN+D E +VR T   IG+  +D+G D   C V+  I +QSP+IAQGV     ++PE+ G
Sbjct:    3 EYAVFTSESVSEGHPDKMADQISDAILDAILKEDPYARVACETLVKTGAVVLAGEITTTANIDVEAVVRQTVNGIGYHHSDLGFDGSTCAVINMIGKQSPEIAQGVD---RQKPEDQG 117          
The following BLAST results are available for this feature:
BLAST of FC931074 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK_STREM1.676e-2855.75S-adenosylmethionine synthetase OS=Streptococcus e... [more]
METK_STRE41.676e-2855.75S-adenosylmethionine synthetase OS=Streptococcus e... [more]
METK_PSYWF1.676e-2857.28S-adenosylmethionine synthetase OS=Psychrobacter s... [more]
METK_PROM41.676e-2854.63S-adenosylmethionine synthetase OS=Prochlorococcus... [more]
METK_POLSJ1.676e-2857.69S-adenosylmethionine synthetase OS=Polaromonas sp.... [more]
METK_LEPCP1.676e-2857.69S-adenosylmethionine synthetase OS=Leptothrix chol... [more]
METK_IDILO1.676e-2856.30S-adenosylmethionine synthetase OS=Idiomarina loih... [more]
METK_BAUCH1.676e-2856.48S-adenosylmethionine synthetase OS=Baumannia cicad... [more]
METK_ACISJ1.676e-2857.69S-adenosylmethionine synthetase OS=Acidovorax sp. ... [more]
METK_ACIBY1.676e-2852.54S-adenosylmethionine synthetase OS=Acinetobacter b... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B05EF PostHarvP1 Citrus clementina cDNA clone C34101B05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931074 ID=FC931074|Name=FC931074|organism=Citrus clementina|type=EST|length=560bp
GAAAAAAAACGAGAGAACTGCGAGTCGAGCTGCCGTTTTAGCGCCTCGCT
CGCTTCTCGCAGCGTATGCATATCGTGTTTCTCTCGGTCTTCTGGGTACT
GACCATTTTCGTATATCACCACCTTCAATTCCATTTGTACTCGCACCACG
GCCTCCTGCAAAGCGAAAGCTGCAGCTTCAGGTTAAATCAAATTAAAGAA
AATGGAAACATTTCTTTTCACATCAGAATCAGTGAACGAGGGTCACCCGG
ACAAGCTGTGTGACCGAGTTTCGGACGCAGTACTGGACGCGTGTTTGGCT
CAGGATCCTGACAGCAAAGTTGCTTGTGAAACATGCACAAAGACCAACAT
GGTCATGGTTTTTGGAGAAATTACAACCAAGGCCAATGTGGATTACGAGA
AAATCGTGCGTGATACATGCAGATCGATTGGGTTCACATCGGCCGATGTG
GGGCTTGATGCTGATCACTGCAAAGTTCTTGTTAATATTGAGCAGCAGAG
CCCTGACATTGCTCAGGGTGTTCATGGGCATCTCACAAAGCGGCCTGAGG
AGATTGGTGC
back to top