FC931074

Overview
NameFC931074
Unique NameFC931074
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length560
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15265 contig Ccv1_Contig15265:1..560. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_ACIBT (S-adenosylmethionine synthetase OS=Acinetobacter baumannii (strain ATCC 17978 / NCDC KC 755) GN=metK PE=3 SV=2)

HSP 1 Score: 125.561 bits (314), Expect = 1.676e-28
Identity = 62/118 (52.54%), Postives = 84/118 (71.19%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            E  +FTSESV+EGHPDK+ D++SDA+LDA L +DP ++VACET  KT  V++ GEITT AN+D E +VR T   IG+  +D+G D   C V+  I +QSP+IAQGV     ++PE+ G
Sbjct:    3 EYAVFTSESVSEGHPDKMADQISDAILDAILKEDPYARVACETLVKTGAVVLAGEITTTANIDVEAVVRQTVNGIGYHHSDLGFDGSTCAVINMIGKQSPEIAQGVD---RQKPEDQG 117          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_ACIBS (S-adenosylmethionine synthetase OS=Acinetobacter baumannii (strain SDF) GN=metK PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.676e-28
Identity = 62/118 (52.54%), Postives = 84/118 (71.19%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            E  +FTSESV+EGHPDK+ D++SDA+LDA L +DP ++VACET  KT  V++ GEITT AN+D E +VR T   IG+  +D+G D   C V+  I +QSP+IAQGV     ++PE+ G
Sbjct:    3 EYAVFTSESVSEGHPDKMADQISDAILDAILKEDPYARVACETLVKTGAVVLAGEITTTANIDVEAVVRQTVNGIGYHHSDLGFDGSTCAVINMIGKQSPEIAQGVD---RQKPEDQG 117          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_ACIBC (S-adenosylmethionine synthetase OS=Acinetobacter baumannii (strain ACICU) GN=metK PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.676e-28
Identity = 62/118 (52.54%), Postives = 84/118 (71.19%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            E  +FTSESV+EGHPDK+ D++SDA+LDA L +DP ++VACET  KT  V++ GEITT AN+D E +VR T   IG+  +D+G D   C V+  I +QSP+IAQGV     ++PE+ G
Sbjct:    3 EYAVFTSESVSEGHPDKMADQISDAILDAILKEDPYARVACETLVKTGAVVLAGEITTTANIDVEAVVRQTVNGIGYHHSDLGFDGSTCAVINMIGKQSPEIAQGVD---RQKPEDQG 117          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_XYLFT (S-adenosylmethionine synthetase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=metK PE=3 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 2.189e-28
Identity = 66/119 (55.46%), Postives = 82/119 (68.91%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            M ++LFTSESV+EGHPDK+ D++SDAVLDA L QDP ++VACET  KT + ++ GEITT A VD E + R     IG+ S+DVG D   C VL  I +QSPDI QGV     K+ EE G
Sbjct:    1 MSSYLFTSESVSEGHPDKVADQISDAVLDAILVQDPRARVACETMVKTGVAIIAGEITTSAWVDLEALTRKVIVDIGYNSSDVGFDGATCGVLNLIGKQSPDINQGVD---RKKAEEQG 116          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_XYLFM (S-adenosylmethionine synthetase OS=Xylella fastidiosa (strain M12) GN=metK PE=3 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 2.189e-28
Identity = 66/119 (55.46%), Postives = 82/119 (68.91%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            M ++LFTSESV+EGHPDK+ D++SDAVLDA L QDP ++VACET  KT + ++ GEITT A VD E + R     IG+ S+DVG D   C VL  I +QSPDI QGV     K+ EE G
Sbjct:    1 MSSYLFTSESVSEGHPDKVADQISDAVLDAILVQDPRARVACETMVKTGVAIIAGEITTSAWVDLEALTRKVIVDIGYNSSDVGFDGATCGVLNLIGKQSPDINQGVD---RKKAEEQG 116          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_XYLFA (S-adenosylmethionine synthetase OS=Xylella fastidiosa GN=metK PE=3 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 2.189e-28
Identity = 66/119 (55.46%), Postives = 82/119 (68.91%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            M ++LFTSESV+EGHPDK+ D++SDAVLDA L QDP ++VACET  KT + ++ GEITT A VD E + R     IG+ S+DVG D   C VL  I +QSPDI QGV     K+ EE G
Sbjct:    1 MSSYLFTSESVSEGHPDKVADQISDAVLDAILVQDPRARVACETMVKTGVAIIAGEITTSAWVDLEALTRKVIVDIGYNSSDVGFDGATCGVLNLIGKQSPDINQGVD---RKKAEEQG 116          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_XYLF2 (S-adenosylmethionine synthetase OS=Xylella fastidiosa (strain M23) GN=metK PE=3 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 2.189e-28
Identity = 66/119 (55.46%), Postives = 82/119 (68.91%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            M ++LFTSESV+EGHPDK+ D++SDAVLDA L QDP ++VACET  KT + ++ GEITT A VD E + R     IG+ S+DVG D   C VL  I +QSPDI QGV     K+ EE G
Sbjct:    1 MSSYLFTSESVSEGHPDKVADQISDAVLDAILVQDPRARVACETMVKTGVAIIAGEITTSAWVDLEALTRKVIVDIGYNSSDVGFDGATCGVLNLIGKQSPDINQGVD---RKKAEEQG 116          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_PSEFS (S-adenosylmethionine synthetase OS=Pseudomonas fluorescens (strain SBW25) GN=metK PE=3 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 2.189e-28
Identity = 65/118 (55.08%), Postives = 84/118 (71.19%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            E  LFTSESV+EGHPDK+ D++SDAVLDA +A+D  ++VACET  KT + ++ GE+TT A VD E+IVRD    IG+TS+DVG D   C V+  I +QSPDI QGV      +PE+ G
Sbjct:    3 EYSLFTSESVSEGHPDKIADQISDAVLDAIIAEDKFARVACETLVKTGVAIIAGEVTTTAWVDLEQIVRDVITDIGYTSSDVGFDGATCGVMNIIGKQSPDINQGVD---RAKPEDQG 117          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_MARMS (S-adenosylmethionine synthetase OS=Marinomonas sp. (strain MWYL1) GN=metK PE=3 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 2.189e-28
Identity = 62/106 (58.49%), Postives = 79/106 (74.53%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            E  LFTSESV+EGHPDK+ D+VSDA+LDA LA+DP+++VACET  KT MV+V GE+ T A VD E+I R   R IG+ S+D+G D + C V+  I +QS DIA GV
Sbjct:    3 EYSLFTSESVSEGHPDKIADQVSDAILDAILAEDPEARVACETLVKTGMVLVAGEVRTNAWVDIEEIARGVIREIGYNSSDMGFDWESCAVMNAIGKQSADIAVGV 108          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_BURVG (S-adenosylmethionine synthetase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=metK PE=3 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 2.189e-28
Identity = 60/104 (57.69%), Postives = 78/104 (75.00%), Query Frame = 1
Query:  211 FLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            + FTSESV+EGHPDK+ D++SDA+LDA L QD  S+VA ET   T +V++ GEITT AN+DY +I RDT + IG+ + D G+D   C VLV  ++QSPDIAQGV
Sbjct:    5 YFFTSESVSEGHPDKVADQISDAILDAILEQDKYSRVAAETLCNTGLVVLAGEITTTANIDYIQIARDTIKRIGYDNTDYGIDYKGCAVLVAYDKQSPDIAQGV 108          
The following BLAST results are available for this feature:
BLAST of FC931074 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK_ACIBT1.676e-2852.54S-adenosylmethionine synthetase OS=Acinetobacter b... [more]
METK_ACIBS1.676e-2852.54S-adenosylmethionine synthetase OS=Acinetobacter b... [more]
METK_ACIBC1.676e-2852.54S-adenosylmethionine synthetase OS=Acinetobacter b... [more]
METK_XYLFT2.189e-2855.46S-adenosylmethionine synthetase OS=Xylella fastidi... [more]
METK_XYLFM2.189e-2855.46S-adenosylmethionine synthetase OS=Xylella fastidi... [more]
METK_XYLFA2.189e-2855.46S-adenosylmethionine synthetase OS=Xylella fastidi... [more]
METK_XYLF22.189e-2855.46S-adenosylmethionine synthetase OS=Xylella fastidi... [more]
METK_PSEFS2.189e-2855.08S-adenosylmethionine synthetase OS=Pseudomonas flu... [more]
METK_MARMS2.189e-2858.49S-adenosylmethionine synthetase OS=Marinomonas sp.... [more]
METK_BURVG2.189e-2857.69S-adenosylmethionine synthetase OS=Burkholderia vi... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B05EF PostHarvP1 Citrus clementina cDNA clone C34101B05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931074 ID=FC931074|Name=FC931074|organism=Citrus clementina|type=EST|length=560bp
GAAAAAAAACGAGAGAACTGCGAGTCGAGCTGCCGTTTTAGCGCCTCGCT
CGCTTCTCGCAGCGTATGCATATCGTGTTTCTCTCGGTCTTCTGGGTACT
GACCATTTTCGTATATCACCACCTTCAATTCCATTTGTACTCGCACCACG
GCCTCCTGCAAAGCGAAAGCTGCAGCTTCAGGTTAAATCAAATTAAAGAA
AATGGAAACATTTCTTTTCACATCAGAATCAGTGAACGAGGGTCACCCGG
ACAAGCTGTGTGACCGAGTTTCGGACGCAGTACTGGACGCGTGTTTGGCT
CAGGATCCTGACAGCAAAGTTGCTTGTGAAACATGCACAAAGACCAACAT
GGTCATGGTTTTTGGAGAAATTACAACCAAGGCCAATGTGGATTACGAGA
AAATCGTGCGTGATACATGCAGATCGATTGGGTTCACATCGGCCGATGTG
GGGCTTGATGCTGATCACTGCAAAGTTCTTGTTAATATTGAGCAGCAGAG
CCCTGACATTGCTCAGGGTGTTCATGGGCATCTCACAAAGCGGCCTGAGG
AGATTGGTGC
back to top