FC931074

Overview
NameFC931074
Unique NameFC931074
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length560
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15265 contig Ccv1_Contig15265:1..560. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_THEEB (S-adenosylmethionine synthetase OS=Thermosynechococcus elongatus (strain BP-1) GN=metK PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 2.859e-28
Identity = 57/104 (54.81%), Postives = 77/104 (74.04%), Query Frame = 1
Query:  211 FLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            +LF+SESV EGHPDK+CD+++DA+LDA L QDP S+VA E    T +V++ GEITTKA V+Y  + R     IG+T A+ G  A+ C VLV +++QSPDIA+GV
Sbjct:    3 YLFSSESVTEGHPDKICDQIADAILDALLTQDPQSRVAAEVVVNTGLVLITGEITTKAQVNYVNLARQKIHEIGYTDANNGFAANSCAVLVALDEQSPDIARGV 106          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_STRPM (S-adenosylmethionine synthetase OS=Streptococcus pyogenes serotype M28 GN=metK PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 2.859e-28
Identity = 62/113 (54.87%), Postives = 81/113 (71.68%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKR 543
            E  LFTSESV+EGHPDK+ D++SDA+LDA LA+DP++ VA ETC  T  V VFGEI+TKA +D  ++VRDT   IG+T A+ G  A+   V  ++ +QS DIAQGV+  L  R
Sbjct:    3 ERKLFTSESVSEGHPDKIADQISDAILDAILAEDPEAHVAAETCVYTGSVHVFGEISTKAYIDINRVVRDTIAEIGYTEAEYGFSAESVGVHPSLVEQSGDIAQGVNEALESR 115          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_RALPJ (S-adenosylmethionine synthetase OS=Ralstonia pickettii (strain 12J) GN=metK PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 2.859e-28
Identity = 60/104 (57.69%), Postives = 79/104 (75.96%), Query Frame = 1
Query:  211 FLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            FLFTSESV+EGHPDK+ D++SDA+LDA LAQD  ++VA ET   T +V++ GEITT ANVDY  + R+T + IG+ + + G+D   C VLV  ++QSPDIAQGV
Sbjct:    5 FLFTSESVSEGHPDKVADQISDAILDAILAQDKYARVAAETLCNTGLVVLAGEITTTANVDYIHVARETIKRIGYDNTEYGIDYKGCAVLVAYDKQSPDIAQGV 108          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_DESVV (S-adenosylmethionine synthetase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=metK PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 2.859e-28
Identity = 58/104 (55.77%), Postives = 78/104 (75.00%), Query Frame = 1
Query:  211 FLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            + FTSESV EGHPDK+ D++SDAVLD  LAQDP+S+VACET   T M ++ GEITT+   D   +VR+T R+IG+ S+++G D   C V+ +I++QS DIAQGV
Sbjct:    8 YYFTSESVTEGHPDKVADQISDAVLDVLLAQDPNSRVACETLVTTGMAVIAGEITTRGYADLPHVVRETIRNIGYNSSEMGFDWQTCAVISSIDKQSADIAQGV 111          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_DESVH (S-adenosylmethionine synthetase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=metK PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 2.859e-28
Identity = 58/104 (55.77%), Postives = 78/104 (75.00%), Query Frame = 1
Query:  211 FLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            + FTSESV EGHPDK+ D++SDAVLD  LAQDP+S+VACET   T M ++ GEITT+   D   +VR+T R+IG+ S+++G D   C V+ +I++QS DIAQGV
Sbjct:    8 YYFTSESVTEGHPDKVADQISDAVLDVLLAQDPNSRVACETLVTTGMAVIAGEITTRGYADLPHVVRETIRNIGYNSSEMGFDWQTCAVISSIDKQSADIAQGV 111          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_BUCAT (S-adenosylmethionine synthetase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=metK PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 2.859e-28
Identity = 61/108 (56.48%), Postives = 79/108 (73.15%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVH 525
            M  +LFTSESV+EGHPDK+ D++SDA+LD  L QD  ++VACET  KT MV++ GEITT A VD E+I R T   IG+ ++D G DA+ C VL  I +QSPDI QG++
Sbjct:    1 MTEYLFTSESVSEGHPDKIADQISDALLDEILKQDLKARVACETYVKTGMVLIGGEITTTAWVDVEEITRKTINDIGYVNSDAGFDANSCAVLSAIGKQSPDINQGIN 108          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_BUCAP (S-adenosylmethionine synthetase OS=Buchnera aphidicola subsp. Schizaphis graminum GN=metK PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 2.859e-28
Identity = 60/107 (56.07%), Postives = 80/107 (74.77%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            M  +LFTSESV+EGHPDK+ D++SDA+LD  + QD  ++VACET  KT MV++ GEITT A VD E+I R+T  +IG+ +++ G DA+ C VL  I +QSPDI QGV
Sbjct:    1 MTEYLFTSESVSEGHPDKIADQISDALLDEIIKQDLKARVACETYVKTGMVLIGGEITTTAWVDVEEITRNTINNIGYINSETGFDANSCAVLSTIGKQSPDITQGV 107          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_BUCAI (S-adenosylmethionine synthetase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum GN=metK PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 2.859e-28
Identity = 61/108 (56.48%), Postives = 79/108 (73.15%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVH 525
            M  +LFTSESV+EGHPDK+ D++SDA+LD  L QD  ++VACET  KT MV++ GEITT A VD E+I R T   IG+ ++D G DA+ C VL  I +QSPDI QG++
Sbjct:    1 MTEYLFTSESVSEGHPDKIADQISDALLDEILKQDLKARVACETYVKTGMVLIGGEITTTAWVDVEEITRKTINDIGYVNSDAGFDANSCAVLSAIGKQSPDINQGIN 108          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_BUCA5 (S-adenosylmethionine synthetase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=metK PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 2.859e-28
Identity = 61/108 (56.48%), Postives = 79/108 (73.15%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVH 525
            M  +LFTSESV+EGHPDK+ D++SDA+LD  L QD  ++VACET  KT MV++ GEITT A VD E+I R T   IG+ ++D G DA+ C VL  I +QSPDI QG++
Sbjct:    1 MTEYLFTSESVSEGHPDKIADQISDALLDEILKQDLKARVACETYVKTGMVLIGGEITTTAWVDVEEITRKTINDIGYVNSDAGFDANSCAVLSAIGKQSPDINQGIN 108          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_STACT (S-adenosylmethionine synthetase OS=Staphylococcus carnosus (strain TM300) GN=metK PE=3 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 3.734e-28
Identity = 61/112 (54.46%), Postives = 77/112 (68.75%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPE 549
            LFTSESV EGHPDK+ D++SDA+LD  L +DPD++VACET   T M M+ GEI+T   VD+ K+VRDT   IG+T A  G D+    V+  I++QSPDIAQ V   L  R E
Sbjct:    7 LFTSESVTEGHPDKIADQISDAILDELLKKDPDARVACETVVTTGMAMIVGEISTATYVDFPKVVRDTVEEIGYTRAKYGYDSQTMAVMSAIDEQSPDIAQAVDRALEYRNE 118          
The following BLAST results are available for this feature:
BLAST of FC931074 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK_THEEB2.859e-2854.81S-adenosylmethionine synthetase OS=Thermosynechoco... [more]
METK_STRPM2.859e-2854.87S-adenosylmethionine synthetase OS=Streptococcus p... [more]
METK_RALPJ2.859e-2857.69S-adenosylmethionine synthetase OS=Ralstonia picke... [more]
METK_DESVV2.859e-2855.77S-adenosylmethionine synthetase OS=Desulfovibrio v... [more]
METK_DESVH2.859e-2855.77S-adenosylmethionine synthetase OS=Desulfovibrio v... [more]
METK_BUCAT2.859e-2856.48S-adenosylmethionine synthetase OS=Buchnera aphidi... [more]
METK_BUCAP2.859e-2856.07S-adenosylmethionine synthetase OS=Buchnera aphidi... [more]
METK_BUCAI2.859e-2856.48S-adenosylmethionine synthetase OS=Buchnera aphidi... [more]
METK_BUCA52.859e-2856.48S-adenosylmethionine synthetase OS=Buchnera aphidi... [more]
METK_STACT3.734e-2854.46S-adenosylmethionine synthetase OS=Staphylococcus ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B05EF PostHarvP1 Citrus clementina cDNA clone C34101B05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931074 ID=FC931074|Name=FC931074|organism=Citrus clementina|type=EST|length=560bp
GAAAAAAAACGAGAGAACTGCGAGTCGAGCTGCCGTTTTAGCGCCTCGCT
CGCTTCTCGCAGCGTATGCATATCGTGTTTCTCTCGGTCTTCTGGGTACT
GACCATTTTCGTATATCACCACCTTCAATTCCATTTGTACTCGCACCACG
GCCTCCTGCAAAGCGAAAGCTGCAGCTTCAGGTTAAATCAAATTAAAGAA
AATGGAAACATTTCTTTTCACATCAGAATCAGTGAACGAGGGTCACCCGG
ACAAGCTGTGTGACCGAGTTTCGGACGCAGTACTGGACGCGTGTTTGGCT
CAGGATCCTGACAGCAAAGTTGCTTGTGAAACATGCACAAAGACCAACAT
GGTCATGGTTTTTGGAGAAATTACAACCAAGGCCAATGTGGATTACGAGA
AAATCGTGCGTGATACATGCAGATCGATTGGGTTCACATCGGCCGATGTG
GGGCTTGATGCTGATCACTGCAAAGTTCTTGTTAATATTGAGCAGCAGAG
CCCTGACATTGCTCAGGGTGTTCATGGGCATCTCACAAAGCGGCCTGAGG
AGATTGGTGC
back to top