FC931074

Overview
NameFC931074
Unique NameFC931074
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length560
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15265 contig Ccv1_Contig15265:1..560. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_COLP3 (S-adenosylmethionine synthetase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=metK PE=3 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 6.369e-28
Identity = 62/119 (52.10%), Postives = 82/119 (68.91%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            M    FTSESV+EGHPDK+ D++SDAVLDA +A+D  ++VACET  KT + ++ GE++T A VD EK+ R+    IG+TS+DVG D   C ++  I QQSP+IAQGV       PEE G
Sbjct:    1 MSRHFFTSESVSEGHPDKIADQISDAVLDAIIAKDKHARVACETMVKTGVAIISGEVSTNAWVDLEKLTRNVISDIGYTSSDVGFDGATCGIMNLIGQQSPEIAQGVD---RSNPEEQG 116          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_BLOFL (S-adenosylmethionine synthetase OS=Blochmannia floridanus GN=metK PE=3 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 6.369e-28
Identity = 58/108 (53.70%), Postives = 81/108 (75.00%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVH 525
            M  FLFTSESV+ GHPDK+ D++SD++LD+ L QDP ++VACET  KT +V++ GEITT A+V+ EKI R+T + IG+T   +GLDA+ C +L  I QQSP+I   ++
Sbjct:    1 MTRFLFTSESVSAGHPDKIADQISDSILDSILEQDPKARVACETYIKTGIVLIGGEITTTASVNIEKIARNTIQEIGYTHPKMGLDANSCVILSVINQQSPEIQYSIN 108          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_STAAW (S-adenosylmethionine synthetase OS=Staphylococcus aureus (strain MW2) GN=metK PE=3 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 8.318e-28
Identity = 60/113 (53.10%), Postives = 79/113 (69.91%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEE 552
            LFTSESV EGHPDK+ D+VSDA+LDA L  DP+++VACET   T M ++ GEI+T   VD  K+VR+T + IG+T A  G D +   +L  I++QSPDIAQGV   L  R ++
Sbjct:    7 LFTSESVTEGHPDKIADQVSDAILDAILKDDPNARVACETTVTTGMALIAGEISTTTYVDIPKVVRETIKEIGYTRAKYGYDYETMAILTAIDEQSPDIAQGVDKALEYRDKD 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_STAAU (S-adenosylmethionine synthetase OS=Staphylococcus aureus GN=metK PE=3 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 8.318e-28
Identity = 60/113 (53.10%), Postives = 79/113 (69.91%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEE 552
            LFTSESV EGHPDK+ D+VSDA+LDA L  DP+++VACET   T M ++ GEI+T   VD  K+VR+T + IG+T A  G D +   +L  I++QSPDIAQGV   L  R ++
Sbjct:    7 LFTSESVTEGHPDKIADQVSDAILDAILKDDPNARVACETTVTTGMALIAGEISTTTYVDIPKVVRETIKEIGYTRAKYGYDYETMAILTAIDEQSPDIAQGVDKALEYRDKD 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_STAAT (S-adenosylmethionine synthetase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=metK PE=3 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 8.318e-28
Identity = 60/113 (53.10%), Postives = 79/113 (69.91%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEE 552
            LFTSESV EGHPDK+ D+VSDA+LDA L  DP+++VACET   T M ++ GEI+T   VD  K+VR+T + IG+T A  G D +   +L  I++QSPDIAQGV   L  R ++
Sbjct:    7 LFTSESVTEGHPDKIADQVSDAILDAILKDDPNARVACETTVTTGMALIAGEISTTTYVDIPKVVRETIKEIGYTRAKYGYDYETMAILTAIDEQSPDIAQGVDKALEYRDKD 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_STAAS (S-adenosylmethionine synthetase OS=Staphylococcus aureus (strain MSSA476) GN=metK PE=3 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 8.318e-28
Identity = 60/113 (53.10%), Postives = 79/113 (69.91%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEE 552
            LFTSESV EGHPDK+ D+VSDA+LDA L  DP+++VACET   T M ++ GEI+T   VD  K+VR+T + IG+T A  G D +   +L  I++QSPDIAQGV   L  R ++
Sbjct:    7 LFTSESVTEGHPDKIADQVSDAILDAILKDDPNARVACETTVTTGMALIAGEISTTTYVDIPKVVRETIKEIGYTRAKYGYDYETMAILTAIDEQSPDIAQGVDKALEYRDKD 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_STAAR (S-adenosylmethionine synthetase OS=Staphylococcus aureus (strain MRSA252) GN=metK PE=3 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 8.318e-28
Identity = 60/113 (53.10%), Postives = 79/113 (69.91%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEE 552
            LFTSESV EGHPDK+ D+VSDA+LDA L  DP+++VACET   T M ++ GEI+T   VD  K+VR+T + IG+T A  G D +   +L  I++QSPDIAQGV   L  R ++
Sbjct:    7 LFTSESVTEGHPDKIADQVSDAILDAILKDDPNARVACETTVTTGMALIAGEISTTTYVDIPKVVRETIKEIGYTRAKYGYDYETMAILTAIDEQSPDIAQGVDKALEYRDKD 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_STAAN (S-adenosylmethionine synthetase OS=Staphylococcus aureus (strain N315) GN=metK PE=1 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 8.318e-28
Identity = 60/113 (53.10%), Postives = 79/113 (69.91%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEE 552
            LFTSESV EGHPDK+ D+VSDA+LDA L  DP+++VACET   T M ++ GEI+T   VD  K+VR+T + IG+T A  G D +   +L  I++QSPDIAQGV   L  R ++
Sbjct:    7 LFTSESVTEGHPDKIADQVSDAILDAILKDDPNARVACETTVTTGMALIAGEISTTTYVDIPKVVRETIKEIGYTRAKYGYDYETMAILTAIDEQSPDIAQGVDKALEYRDKD 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_STAAM (S-adenosylmethionine synthetase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=metK PE=1 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 8.318e-28
Identity = 60/113 (53.10%), Postives = 79/113 (69.91%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEE 552
            LFTSESV EGHPDK+ D+VSDA+LDA L  DP+++VACET   T M ++ GEI+T   VD  K+VR+T + IG+T A  G D +   +L  I++QSPDIAQGV   L  R ++
Sbjct:    7 LFTSESVTEGHPDKIADQVSDAILDAILKDDPNARVACETTVTTGMALIAGEISTTTYVDIPKVVRETIKEIGYTRAKYGYDYETMAILTAIDEQSPDIAQGVDKALEYRDKD 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_STAAE (S-adenosylmethionine synthetase OS=Staphylococcus aureus (strain Newman) GN=metK PE=3 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 8.318e-28
Identity = 60/113 (53.10%), Postives = 79/113 (69.91%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEE 552
            LFTSESV EGHPDK+ D+VSDA+LDA L  DP+++VACET   T M ++ GEI+T   VD  K+VR+T + IG+T A  G D +   +L  I++QSPDIAQGV   L  R ++
Sbjct:    7 LFTSESVTEGHPDKIADQVSDAILDAILKDDPNARVACETTVTTGMALIAGEISTTTYVDIPKVVRETIKEIGYTRAKYGYDYETMAILTAIDEQSPDIAQGVDKALEYRDKD 119          
The following BLAST results are available for this feature:
BLAST of FC931074 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK_COLP36.369e-2852.10S-adenosylmethionine synthetase OS=Colwellia psych... [more]
METK_BLOFL6.369e-2853.70S-adenosylmethionine synthetase OS=Blochmannia flo... [more]
METK_STAAW8.318e-2853.10S-adenosylmethionine synthetase OS=Staphylococcus ... [more]
METK_STAAU8.318e-2853.10S-adenosylmethionine synthetase OS=Staphylococcus ... [more]
METK_STAAT8.318e-2853.10S-adenosylmethionine synthetase OS=Staphylococcus ... [more]
METK_STAAS8.318e-2853.10S-adenosylmethionine synthetase OS=Staphylococcus ... [more]
METK_STAAR8.318e-2853.10S-adenosylmethionine synthetase OS=Staphylococcus ... [more]
METK_STAAN8.318e-2853.10S-adenosylmethionine synthetase OS=Staphylococcus ... [more]
METK_STAAM8.318e-2853.10S-adenosylmethionine synthetase OS=Staphylococcus ... [more]
METK_STAAE8.318e-2853.10S-adenosylmethionine synthetase OS=Staphylococcus ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B05EF PostHarvP1 Citrus clementina cDNA clone C34101B05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931074 ID=FC931074|Name=FC931074|organism=Citrus clementina|type=EST|length=560bp
GAAAAAAAACGAGAGAACTGCGAGTCGAGCTGCCGTTTTAGCGCCTCGCT
CGCTTCTCGCAGCGTATGCATATCGTGTTTCTCTCGGTCTTCTGGGTACT
GACCATTTTCGTATATCACCACCTTCAATTCCATTTGTACTCGCACCACG
GCCTCCTGCAAAGCGAAAGCTGCAGCTTCAGGTTAAATCAAATTAAAGAA
AATGGAAACATTTCTTTTCACATCAGAATCAGTGAACGAGGGTCACCCGG
ACAAGCTGTGTGACCGAGTTTCGGACGCAGTACTGGACGCGTGTTTGGCT
CAGGATCCTGACAGCAAAGTTGCTTGTGAAACATGCACAAAGACCAACAT
GGTCATGGTTTTTGGAGAAATTACAACCAAGGCCAATGTGGATTACGAGA
AAATCGTGCGTGATACATGCAGATCGATTGGGTTCACATCGGCCGATGTG
GGGCTTGATGCTGATCACTGCAAAGTTCTTGTTAATATTGAGCAGCAGAG
CCCTGACATTGCTCAGGGTGTTCATGGGCATCTCACAAAGCGGCCTGAGG
AGATTGGTGC
back to top