FC931074

Overview
NameFC931074
Unique NameFC931074
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length560
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15265 contig Ccv1_Contig15265:1..560. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_HAEPS (S-adenosylmethionine synthetase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=metK PE=3 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 8.318e-28
Identity = 62/103 (60.19%), Postives = 74/103 (71.84%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            LFTSESV+EGHPDK+ D++SDAVLD  L QDP ++VACET  KT M +V GEITT A VD E + R     IG+T +D+G DA  C VL  I +QSPDI QGV
Sbjct:    5 LFTSESVSEGHPDKIADQISDAVLDEILKQDPKARVACETYVKTGMALVGGEITTSAWVDIENLTRQVICDIGYTHSDMGFDAHSCAVLNAIGKQSPDINQGV 107          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_CHRVO (S-adenosylmethionine synthetase OS=Chromobacterium violaceum GN=metK PE=3 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 8.318e-28
Identity = 58/108 (53.70%), Postives = 80/108 (74.07%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVH 525
            M  +LFTSESV+EGHPDK+ D++SDA+LDA L +D  ++VA ET   T +V++ GEITT ANVDY KI R+T + IG+  +++G D   C V+   ++QSPDIAQGV+
Sbjct:    1 MSEYLFTSESVSEGHPDKVADQISDAILDAILREDKHARVAAETLVNTGLVVLAGEITTTANVDYIKIARETIKRIGYDDSELGFDFRGCAVMACYDKQSPDIAQGVN 108          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_BIFAA (S-adenosylmethionine synthetase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083) GN=metK PE=3 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 8.318e-28
Identity = 59/106 (55.66%), Postives = 76/106 (71.70%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            E  L ++ESV EGHPDK+CD++SDA+LD  LAQDP S VA ETC       VFGE+T++   D + IVR   R+IG+TS+ VGLDAD C V V++ +QSP+I QGV
Sbjct:    3 ELKLISAESVTEGHPDKVCDQISDAILDDMLAQDPHSHVAVETCATVGQFFVFGEVTSEGYSDIQNIVRSVVRNIGYTSSRVGLDADSCGVTVSLTEQSPEINQGV 108          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_AZOSE (S-adenosylmethionine synthetase OS=Azoarcus sp. (strain EbN1) GN=metK PE=3 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 8.318e-28
Identity = 58/105 (55.24%), Postives = 78/105 (74.29%), Query Frame = 1
Query:  211 FLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVH 525
            +LFTSESV+EGHPDK+ D+VSD VLDA LA DP ++VACET   T +V++ GEITT A+ +Y +I ++  R IG+ ++D+G D   C VL  I +QS DIAQGV+
Sbjct:    5 YLFTSESVSEGHPDKVADQVSDGVLDAILATDPQARVACETLVSTGLVVISGEITTTAHPNYREIAQEVIRRIGYDNSDIGFDYKSCAVLAAINRQSADIAQGVN 109          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_ACTPJ (S-adenosylmethionine synthetase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=metK PE=3 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 8.318e-28
Identity = 62/103 (60.19%), Postives = 74/103 (71.84%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            LFTSESV+EGHPDK+ D++SDAVLD  L QDP ++VACET  KT M +V GEITT A VD E + R     IG+T +D+G DA  C VL  I +QSPDI QGV
Sbjct:    5 LFTSESVSEGHPDKIADQISDAVLDEILKQDPKARVACETYVKTGMALVGGEITTSAWVDIENLTRQVICDIGYTHSDMGFDAHSCAVLNAIGKQSPDINQGV 107          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_ACTP7 (S-adenosylmethionine synthetase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=metK PE=3 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 8.318e-28
Identity = 62/103 (60.19%), Postives = 74/103 (71.84%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            LFTSESV+EGHPDK+ D++SDAVLD  L QDP ++VACET  KT M +V GEITT A VD E + R     IG+T +D+G DA  C VL  I +QSPDI QGV
Sbjct:    5 LFTSESVSEGHPDKIADQISDAVLDEILKQDPKARVACETYVKTGMALVGGEITTSAWVDIENLTRQVICDIGYTHSDMGFDAHSCAVLNAIGKQSPDINQGV 107          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_ACTP2 (S-adenosylmethionine synthetase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=metK PE=3 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 8.318e-28
Identity = 62/103 (60.19%), Postives = 74/103 (71.84%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            LFTSESV+EGHPDK+ D++SDAVLD  L QDP ++VACET  KT M +V GEITT A VD E + R     IG+T +D+G DA  C VL  I +QSPDI QGV
Sbjct:    5 LFTSESVSEGHPDKIADQISDAVLDEILKQDPKARVACETYVKTGMALVGGEITTSAWVDIENLTRQVICDIGYTHSDMGFDAHSCAVLNAIGKQSPDINQGV 107          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_THET8 (S-adenosylmethionine synthetase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=metK PE=3 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.086e-27
Identity = 61/104 (58.65%), Postives = 74/104 (71.15%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVH 525
            L TSESV EGHPDKL DR+SDA+LDA +AQD  ++VA ET   T +V V GEITT+  VD   +VR T R +G+T A  G DAD C VL  I++QSPDIA GV+
Sbjct:    6 LVTSESVTEGHPDKLADRISDAILDALIAQDKKARVAAETLVTTGLVFVAGEITTEGYVDIPNLVRKTVREVGYTRAKYGFDADTCAVLTAIDEQSPDIAGGVN 109          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_THET2 (S-adenosylmethionine synthetase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=metK PE=3 SV=2)

HSP 1 Score: 122.865 bits (307), Expect = 1.086e-27
Identity = 61/104 (58.65%), Postives = 74/104 (71.15%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVH 525
            L TSESV EGHPDKL DR+SDA+LDA +AQD  ++VA ET   T +V V GEITT+  VD   +VR T R +G+T A  G DAD C VL  I++QSPDIA GV+
Sbjct:    6 LVTSESVTEGHPDKLADRISDAILDALIAQDKKARVAAETLVTTGLVFVAGEITTEGYVDIPNLVRKTVREVGYTRAKYGFDADTCAVLTAIDEQSPDIAGGVN 109          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_STRSY (S-adenosylmethionine synthetase OS=Streptococcus suis (strain 05ZYH33) GN=metK PE=3 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.086e-27
Identity = 62/115 (53.91%), Postives = 80/115 (69.57%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPE 549
            E  LFTSESV+EGHPDK+ D++SDA+LDA LA+DPD+ VA ET   T  V VFGEI+T A VD  ++VRDT   IG+T  + G  A+   V  ++ +QSPDIAQGV+  L  R +
Sbjct:    3 ERKLFTSESVSEGHPDKIADQISDAILDAILAEDPDAHVAAETAVYTGSVHVFGEISTTAYVDINRVVRDTIAEIGYTKGEYGFSAESVGVHPSLVEQSPDIAQGVNEALETRQD 117          
The following BLAST results are available for this feature:
BLAST of FC931074 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK_HAEPS8.318e-2860.19S-adenosylmethionine synthetase OS=Haemophilus par... [more]
METK_CHRVO8.318e-2853.70S-adenosylmethionine synthetase OS=Chromobacterium... [more]
METK_BIFAA8.318e-2855.66S-adenosylmethionine synthetase OS=Bifidobacterium... [more]
METK_AZOSE8.318e-2855.24S-adenosylmethionine synthetase OS=Azoarcus sp. (s... [more]
METK_ACTPJ8.318e-2860.19S-adenosylmethionine synthetase OS=Actinobacillus ... [more]
METK_ACTP78.318e-2860.19S-adenosylmethionine synthetase OS=Actinobacillus ... [more]
METK_ACTP28.318e-2860.19S-adenosylmethionine synthetase OS=Actinobacillus ... [more]
METK_THET81.086e-2758.65S-adenosylmethionine synthetase OS=Thermus thermop... [more]
METK_THET21.086e-2758.65S-adenosylmethionine synthetase OS=Thermus thermop... [more]
METK_STRSY1.086e-2753.91S-adenosylmethionine synthetase OS=Streptococcus s... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B05EF PostHarvP1 Citrus clementina cDNA clone C34101B05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931074 ID=FC931074|Name=FC931074|organism=Citrus clementina|type=EST|length=560bp
GAAAAAAAACGAGAGAACTGCGAGTCGAGCTGCCGTTTTAGCGCCTCGCT
CGCTTCTCGCAGCGTATGCATATCGTGTTTCTCTCGGTCTTCTGGGTACT
GACCATTTTCGTATATCACCACCTTCAATTCCATTTGTACTCGCACCACG
GCCTCCTGCAAAGCGAAAGCTGCAGCTTCAGGTTAAATCAAATTAAAGAA
AATGGAAACATTTCTTTTCACATCAGAATCAGTGAACGAGGGTCACCCGG
ACAAGCTGTGTGACCGAGTTTCGGACGCAGTACTGGACGCGTGTTTGGCT
CAGGATCCTGACAGCAAAGTTGCTTGTGAAACATGCACAAAGACCAACAT
GGTCATGGTTTTTGGAGAAATTACAACCAAGGCCAATGTGGATTACGAGA
AAATCGTGCGTGATACATGCAGATCGATTGGGTTCACATCGGCCGATGTG
GGGCTTGATGCTGATCACTGCAAAGTTCTTGTTAATATTGAGCAGCAGAG
CCCTGACATTGCTCAGGGTGTTCATGGGCATCTCACAAAGCGGCCTGAGG
AGATTGGTGC
back to top