FC931074

Overview
NameFC931074
Unique NameFC931074
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length560
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15265 contig Ccv1_Contig15265:1..560. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_STRS2 (S-adenosylmethionine synthetase OS=Streptococcus suis (strain 98HAH33) GN=metK PE=3 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.086e-27
Identity = 62/115 (53.91%), Postives = 80/115 (69.57%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPE 549
            E  LFTSESV+EGHPDK+ D++SDA+LDA LA+DPD+ VA ET   T  V VFGEI+T A VD  ++VRDT   IG+T  + G  A+   V  ++ +QSPDIAQGV+  L  R +
Sbjct:    3 ERKLFTSESVSEGHPDKIADQISDAILDAILAEDPDAHVAAETAVYTGSVHVFGEISTTAYVDINRVVRDTIAEIGYTKGEYGFSAESVGVHPSLVEQSPDIAQGVNEALETRQD 117          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_STAS1 (S-adenosylmethionine synthetase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=metK PE=3 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.086e-27
Identity = 61/112 (54.46%), Postives = 77/112 (68.75%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPE 549
            LFTSESV EGHPDK+ D+VSDA+LD  L  DP+++VACET   T M ++ GEI+T   VD  K+VR+T + IG+T A  G D+    VL  I++QSPDIAQGV   L  R E
Sbjct:    7 LFTSESVTEGHPDKIADQVSDAILDEILKDDPNARVACETTVTTGMALISGEISTTTYVDIPKVVRETIKEIGYTRAKFGYDSQTMAVLTAIDEQSPDIAQGVDTALEYRDE 118          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_PSEMY (S-adenosylmethionine synthetase OS=Pseudomonas mendocina (strain ymp) GN=metK PE=3 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.086e-27
Identity = 64/118 (54.24%), Postives = 84/118 (71.19%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            E  LFTSESV+EGHPDK+ D++SDAVLDA + QD  ++VA ET  KT + +V GE+TT A VD E+IVRD   +IG+TS+DVG D + C ++  I +QSPDI QGV      +PE+ G
Sbjct:    3 EYSLFTSESVSEGHPDKIADQISDAVLDAIIVQDKHARVAVETLVKTGVAIVAGEVTTSAWVDLEQIVRDVICNIGYTSSDVGFDGNTCGIINIIGKQSPDINQGVD---RAKPEDQG 117          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_MOOTA (S-adenosylmethionine synthetase OS=Moorella thermoacetica (strain ATCC 39073) GN=metK PE=3 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.086e-27
Identity = 58/113 (51.33%), Postives = 78/113 (69.03%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEE 552
            LFTSESV EGHPDK+ DR++DAVLDA  A+D  ++VACE    T +++V G+ITT   VD  ++ R+T R IG+T A  G D D C V+ +I++QSPDIA GV+    K+  E
Sbjct:    5 LFTSESVTEGHPDKIADRIADAVLDAIYAKDNQARVACECLVSTGLILVAGQITTDCYVDIPRVARETVREIGYTRAKFGFDCDTCAVITSIDEQSPDIAMGVNEAWEKKQGE 117          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_MARAV (S-adenosylmethionine synthetase OS=Marinobacter aquaeolei (strain ATCC 700491 / DSM 11845 / VT8) GN=metK PE=3 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.086e-27
Identity = 64/115 (55.65%), Postives = 82/115 (71.30%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            +FTSESV+EGHPDKL D++SDAVLDA L  DP ++VACET  KT + +V GEITT A VD E +VR   + I +TS++VG D D C V+  I +QS DIAQGV     ++PE+ G
Sbjct:    6 IFTSESVSEGHPDKLADQISDAVLDAILTDDPHARVACETMVKTGVAIVGGEITTSAWVDLEDLVRGVIKDIDYTSSEVGYDGDTCGVINIIGKQSVDIAQGVD---RQKPEDQG 117          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_LEIXX (S-adenosylmethionine synthetase OS=Leifsonia xyli subsp. xyli GN=metK PE=3 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.086e-27
Identity = 63/112 (56.25%), Postives = 76/112 (67.86%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPE 549
            LFTSESV EGHPDK+CD++SD++LDA LA D  S+VA ET   T +V V GE+TTK  V+   +VRDT   IG+ S+DV  D   C V V+I  QSPDIAQGV   L  R E
Sbjct:    6 LFTSESVTEGHPDKICDQISDSILDALLAVDEHSRVAVETLVTTGLVHVAGEVTTKGYVEIPALVRDTIVEIGYDSSDVSFDGTQCGVSVSIGAQSPDIAQGVDNALETRSE 117          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_CYAP7 (S-adenosylmethionine synthetase OS=Cyanothece sp. (strain PCC 7424) GN=metK PE=3 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.086e-27
Identity = 56/104 (53.85%), Postives = 77/104 (74.04%), Query Frame = 1
Query:  211 FLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            +LFTSESV EGHPDK+CD++SD +LDA L+QDP S+VA E    T +V++ GEIT+KA V+Y  + R     IG+T ++ G  A+ C VLV +++QSPDI+QGV
Sbjct:    5 YLFTSESVTEGHPDKICDQISDTILDALLSQDPYSRVAAEVVVNTGLVLITGEITSKAQVNYVDLARQKIAEIGYTDSNNGFSANSCAVLVALDEQSPDISQGV 108          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_WIGBR (S-adenosylmethionine synthetase OS=Wigglesworthia glossinidia brevipalpis GN=metK PE=3 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 1.419e-27
Identity = 54/108 (50.00%), Postives = 82/108 (75.93%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVH 525
            M  +LFTSESV+EGHPDK+ D++SD +LDA L QD  ++VACET  KT MV+V GE+ + A +D E+++R+T + IG+ ++++G DA+ C +L NI +QS DI +G++
Sbjct:    1 MNQYLFTSESVSEGHPDKIADQISDTILDAILTQDKKARVACETYIKTGMVLVGGEVNSYAKIDIEELIRNTIKDIGYINSNMGFDANSCAILNNISKQSKDIEKGLN 108          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_SYNY3 (S-adenosylmethionine synthetase OS=Synechocystis sp. (strain PCC 6803) GN=metK PE=3 SV=2)

HSP 1 Score: 122.479 bits (306), Expect = 1.419e-27
Identity = 54/104 (51.92%), Postives = 80/104 (76.92%), Query Frame = 1
Query:  211 FLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            +LFTSESV EGHPDK+CD++SD +LDA L  DP+S+VA ET   T + +V GEIT++A++++ +++R     IG+T+AD G  A+ C V++ I++QSPDI+QGV
Sbjct:   11 YLFTSESVTEGHPDKVCDQISDTILDALLTLDPNSRVAAETVVNTGLTLVTGEITSQAHINFVELIRQKIAEIGYTNADNGYSANSCAVMLAIDEQSPDISQGV 114          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_STRPZ (S-adenosylmethionine synthetase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=metK PE=3 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 1.419e-27
Identity = 61/113 (53.98%), Postives = 80/113 (70.80%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKR 543
            E  LFTSESV+EGHPDK+ D++SDA+LDA LA+DP++ VA ETC  T  V VFGEI+T A +D  ++VRDT   IG+T A+ G  A+   V  ++ +QS DIAQGV+  L  R
Sbjct:    3 ERKLFTSESVSEGHPDKIADQISDAILDAILAEDPEAHVAAETCVYTGSVHVFGEISTTAYIDINRVVRDTIAEIGYTEAEYGFSAESVGVHPSLVEQSGDIAQGVNEALESR 115          
The following BLAST results are available for this feature:
BLAST of FC931074 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK_STRS21.086e-2753.91S-adenosylmethionine synthetase OS=Streptococcus s... [more]
METK_STAS11.086e-2754.46S-adenosylmethionine synthetase OS=Staphylococcus ... [more]
METK_PSEMY1.086e-2754.24S-adenosylmethionine synthetase OS=Pseudomonas men... [more]
METK_MOOTA1.086e-2751.33S-adenosylmethionine synthetase OS=Moorella thermo... [more]
METK_MARAV1.086e-2755.65S-adenosylmethionine synthetase OS=Marinobacter aq... [more]
METK_LEIXX1.086e-2756.25S-adenosylmethionine synthetase OS=Leifsonia xyli ... [more]
METK_CYAP71.086e-2753.85S-adenosylmethionine synthetase OS=Cyanothece sp. ... [more]
METK_WIGBR1.419e-2750.00S-adenosylmethionine synthetase OS=Wigglesworthia ... [more]
METK_SYNY31.419e-2751.92S-adenosylmethionine synthetase OS=Synechocystis s... [more]
METK_STRPZ1.419e-2753.98S-adenosylmethionine synthetase OS=Streptococcus p... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B05EF PostHarvP1 Citrus clementina cDNA clone C34101B05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931074 ID=FC931074|Name=FC931074|organism=Citrus clementina|type=EST|length=560bp
GAAAAAAAACGAGAGAACTGCGAGTCGAGCTGCCGTTTTAGCGCCTCGCT
CGCTTCTCGCAGCGTATGCATATCGTGTTTCTCTCGGTCTTCTGGGTACT
GACCATTTTCGTATATCACCACCTTCAATTCCATTTGTACTCGCACCACG
GCCTCCTGCAAAGCGAAAGCTGCAGCTTCAGGTTAAATCAAATTAAAGAA
AATGGAAACATTTCTTTTCACATCAGAATCAGTGAACGAGGGTCACCCGG
ACAAGCTGTGTGACCGAGTTTCGGACGCAGTACTGGACGCGTGTTTGGCT
CAGGATCCTGACAGCAAAGTTGCTTGTGAAACATGCACAAAGACCAACAT
GGTCATGGTTTTTGGAGAAATTACAACCAAGGCCAATGTGGATTACGAGA
AAATCGTGCGTGATACATGCAGATCGATTGGGTTCACATCGGCCGATGTG
GGGCTTGATGCTGATCACTGCAAAGTTCTTGTTAATATTGAGCAGCAGAG
CCCTGACATTGCTCAGGGTGTTCATGGGCATCTCACAAAGCGGCCTGAGG
AGATTGGTGC
back to top