FC931074

Overview
NameFC931074
Unique NameFC931074
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length560
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15265 contig Ccv1_Contig15265:1..560. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_SYNJA (S-adenosylmethionine synthetase OS=Synechococcus sp. (strain JA-3-3Ab) GN=metK PE=3 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 1.853e-27
Identity = 58/113 (51.33%), Postives = 81/113 (71.68%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEE 552
            +F+SESV EGHPDK+CD++SDA++DA L  DP S+VA E    T MV++ GEIT++A+V++ ++VRD    IG+T A  G  A+ C VLV  ++QSPDIAQGV+  L  R  +
Sbjct:    1 MFSSESVTEGHPDKICDQISDAIVDALLTADPLSRVAAEVVVNTGMVILTGEITSQAHVNFTRLVRDKVAEIGYTDAKNGFSAESCAVLVAFDEQSPDIAQGVNLALESRTSQ 113          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_STRSV (S-adenosylmethionine synthetase OS=Streptococcus sanguinis (strain SK36) GN=metK PE=3 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 1.853e-27
Identity = 62/113 (54.87%), Postives = 80/113 (70.80%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKR 543
            E  LFTSESV+EGHPDK+ D++SDA+LDA L+QDPD+ VA ET   T  V VFGEI+T A VD  ++VRDT   IG+T+ + G  A+   V  ++ +QSPDIAQGV+  L  R
Sbjct:    3 ERKLFTSESVSEGHPDKIADQISDAILDAVLSQDPDAHVAAETAVYTGSVHVFGEISTTAYVDINRVVRDTIAEIGYTNTEYGFSAETVGVHPSLVEQSPDIAQGVNEALEVR 115          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_STRGC (S-adenosylmethionine synthetase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=metK PE=3 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 1.853e-27
Identity = 62/113 (54.87%), Postives = 80/113 (70.80%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKR 543
            E  LFTSESV+EGHPDK+ D++SDA+LDA L+QDPD+ VA ET   T  V VFGEI+T A VD  ++VRDT   IG+T+ + G  A+   V  ++ +QSPDIAQGV+  L  R
Sbjct:    3 ERKLFTSESVSEGHPDKIADQISDAILDAVLSQDPDAHVAAETAVYTGSVHVFGEISTTAYVDINRVVRDTIAEIGYTNTEYGFSAETVGVHPSLVEQSPDIAQGVNEALEVR 115          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_RICPR (S-adenosylmethionine synthetase OS=Rickettsia prowazekii GN=metK PE=3 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 1.853e-27
Identity = 60/119 (50.42%), Postives = 82/119 (68.91%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            M+ F+FTSESV+EGHPDK+ D++SDAVLD  L  DP+ +VACET   T +V+V GEITT   VD E++VR+  + IG+ + + G D   C V+ +I +QSPDIA G+     +  EEIG
Sbjct:    1 MKNFVFTSESVSEGHPDKIADQISDAVLDEILKHDPNGRVACETFVTTGLVLVGGEITTNTYVDIEQVVRNKIQEIGYNNPNYGFDGSCCAVISSIIKQSPDIAMGID---NENEEEIG 116          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_HAEDU (S-adenosylmethionine synthetase OS=Haemophilus ducreyi GN=metK PE=3 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 1.853e-27
Identity = 61/103 (59.22%), Postives = 74/103 (71.84%), Query Frame = 1
Query:  214 LFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            LFTSESV+EGHPDK+ D++SDAVLD  L QDP ++VACET  KT M +V GEITT A VD E + R     IG++ +D+G DA  C VL  I +QSPDI QGV
Sbjct:   10 LFTSESVSEGHPDKIADQISDAVLDEILKQDPKARVACETYVKTGMALVGGEITTSAWVDIENLTRQVIYDIGYSHSDMGFDAHSCAVLNAIGKQSPDINQGV 112          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_DEHE1 (S-adenosylmethionine synthetase OS=Dehalococcoides ethenogenes (strain 195) GN=metK PE=3 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 1.853e-27
Identity = 57/105 (54.29%), Postives = 76/105 (72.38%), Query Frame = 1
Query:  211 FLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVH 525
            +LFTSESV EGHPDK+CD++SDAVLDA +A+DP++ VACET     +V+V GEITT   V+  ++VR   + IG+T  + G D   C VL +I +QSPDIA GV+
Sbjct:   11 YLFTSESVTEGHPDKICDQISDAVLDAIIAKDPNAHVACETAVTNGLVVVMGEITTSCYVEIPELVRGVIKDIGYTKPEYGFDDRTCGVLTSINRQSPDIALGVN 115          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_COXBN (S-adenosylmethionine synthetase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=metK PE=3 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 1.853e-27
Identity = 61/117 (52.14%), Postives = 80/117 (68.38%), Query Frame = 1
Query:  208 TFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            T LFTSESV+EGHPDK+ D++SDAVLDA ++QDP+ +VACE   K+ MV V GEITT A  D E+I R+T   IG+    +G D + C V+  I +QSPDI  GV G   +  +E+G
Sbjct:    4 TTLFTSESVSEGHPDKVADQISDAVLDALISQDPNCRVACEAVVKSGMVFVAGEITTNAWADVEQITRNTVLQIGYNDPHLGFDGETCAVVTAIGKQSPDIVMGVDG---REDQELG 117          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_COXBU (S-adenosylmethionine synthetase OS=Coxiella burnetii GN=metK PE=3 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 2.420e-27
Identity = 61/117 (52.14%), Postives = 79/117 (67.52%), Query Frame = 1
Query:  208 TFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            T LFTSESV+EGHPDK+ D++SDAVLDA + QDP+ +VACE   K+ MV V GEITT A  D E+I R+T   IG+    +G D + C V+  I +QSPDI  GV G   +  +E+G
Sbjct:    4 TTLFTSESVSEGHPDKVADQISDAVLDALIGQDPNCRVACEAVVKSGMVFVAGEITTNAWADVEQITRNTVLQIGYNDPHLGFDGETCAVVTAIGKQSPDIVMGVDG---REDQELG 117          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_COXBR (S-adenosylmethionine synthetase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=metK PE=3 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 2.420e-27
Identity = 61/117 (52.14%), Postives = 79/117 (67.52%), Query Frame = 1
Query:  208 TFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            T LFTSESV+EGHPDK+ D++SDAVLDA + QDP+ +VACE   K+ MV V GEITT A  D E+I R+T   IG+    +G D + C V+  I +QSPDI  GV G   +  +E+G
Sbjct:    4 TTLFTSESVSEGHPDKVADQISDAVLDALIGQDPNCRVACEAVVKSGMVFVAGEITTNAWADVEQITRNTVLQIGYNDPHLGFDGETCAVVTAIGKQSPDIVMGVDG---REDQELG 117          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_COXB2 (S-adenosylmethionine synthetase OS=Coxiella burnetii (strain CbuG_Q212) GN=metK PE=3 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 2.420e-27
Identity = 61/117 (52.14%), Postives = 79/117 (67.52%), Query Frame = 1
Query:  208 TFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            T LFTSESV+EGHPDK+ D++SDAVLDA + QDP+ +VACE   K+ MV V GEITT A  D E+I R+T   IG+    +G D + C V+  I +QSPDI  GV G   +  +E+G
Sbjct:    4 TTLFTSESVSEGHPDKVADQISDAVLDALIGQDPNCRVACEAVVKSGMVFVAGEITTNAWADVEQITRNTVLQIGYNDPHLGFDGETCAVVTAIGKQSPDIVMGVDG---REDQELG 117          
The following BLAST results are available for this feature:
BLAST of FC931074 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK_SYNJA1.853e-2751.33S-adenosylmethionine synthetase OS=Synechococcus s... [more]
METK_STRSV1.853e-2754.87S-adenosylmethionine synthetase OS=Streptococcus s... [more]
METK_STRGC1.853e-2754.87S-adenosylmethionine synthetase OS=Streptococcus g... [more]
METK_RICPR1.853e-2750.42S-adenosylmethionine synthetase OS=Rickettsia prow... [more]
METK_HAEDU1.853e-2759.22S-adenosylmethionine synthetase OS=Haemophilus duc... [more]
METK_DEHE11.853e-2754.29S-adenosylmethionine synthetase OS=Dehalococcoides... [more]
METK_COXBN1.853e-2752.14S-adenosylmethionine synthetase OS=Coxiella burnet... [more]
METK_COXBU2.420e-2752.14S-adenosylmethionine synthetase OS=Coxiella burnet... [more]
METK_COXBR2.420e-2752.14S-adenosylmethionine synthetase OS=Coxiella burnet... [more]
METK_COXB22.420e-2752.14S-adenosylmethionine synthetase OS=Coxiella burnet... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B05EF PostHarvP1 Citrus clementina cDNA clone C34101B05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931074 ID=FC931074|Name=FC931074|organism=Citrus clementina|type=EST|length=560bp
GAAAAAAAACGAGAGAACTGCGAGTCGAGCTGCCGTTTTAGCGCCTCGCT
CGCTTCTCGCAGCGTATGCATATCGTGTTTCTCTCGGTCTTCTGGGTACT
GACCATTTTCGTATATCACCACCTTCAATTCCATTTGTACTCGCACCACG
GCCTCCTGCAAAGCGAAAGCTGCAGCTTCAGGTTAAATCAAATTAAAGAA
AATGGAAACATTTCTTTTCACATCAGAATCAGTGAACGAGGGTCACCCGG
ACAAGCTGTGTGACCGAGTTTCGGACGCAGTACTGGACGCGTGTTTGGCT
CAGGATCCTGACAGCAAAGTTGCTTGTGAAACATGCACAAAGACCAACAT
GGTCATGGTTTTTGGAGAAATTACAACCAAGGCCAATGTGGATTACGAGA
AAATCGTGCGTGATACATGCAGATCGATTGGGTTCACATCGGCCGATGTG
GGGCTTGATGCTGATCACTGCAAAGTTCTTGTTAATATTGAGCAGCAGAG
CCCTGACATTGCTCAGGGTGTTCATGGGCATCTCACAAAGCGGCCTGAGG
AGATTGGTGC
back to top