FC931074

Overview
NameFC931074
Unique NameFC931074
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length560
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15265 contig Ccv1_Contig15265:1..560. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK4_ATRNU (S-adenosylmethionine synthetase 4 OS=Atriplex nummularia GN=SAMS4 PE=1 SV=1)

HSP 1 Score: 226.483 bits (576), Expect = 6.976e-59
Identity = 107/119 (89.92%), Postives = 115/119 (96.64%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            ++TFLFTSESVNEGHPDKLCD++SDAVLDACLAQDP+SKVACETCTKTN+VMVFGEITTKANVDYEKIVR TCR IGF SADVGLDAD+CKVLV IEQQSPDIAQGVHGHLT+RPEEIG
Sbjct:    5 VDTFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPESKVACETCTKTNLVMVFGEITTKANVDYEKIVRQTCRDIGFVSADVGLDADNCKVLVYIEQQSPDIAQGVHGHLTRRPEEIG 123          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK1_TRIMO (S-adenosylmethionine synthetase 1 OS=Triticum monococcum GN=SAMS1 PE=2 SV=1)

HSP 1 Score: 226.098 bits (575), Expect = 9.112e-59
Identity = 109/118 (92.37%), Postives = 112/118 (94.92%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            ETFLFTSESVNEGHPDKLCD+VSDAVLDACLAQD DSKVACETCTKTNMVMVFGEITTKA VDYEKIVRDTCR+IGF S DVGLDAD CKVLVNIEQQSPDIAQGVHGH TKRPE+IG
Sbjct:    4 ETFLFTSESVNEGHPDKLCDQVSDAVLDACLAQDADSKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRNIGFISDDVGLDADRCKVLVNIEQQSPDIAQGVHGHFTKRPEDIG 121          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_SOLBR (S-adenosylmethionine synthetase OS=Solanum brevidens GN=SAMS PE=2 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 1.554e-58
Identity = 108/119 (90.76%), Postives = 114/119 (95.80%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            METFLFTSESVNEGHPDKLCD++SDAVLDACL QDP+SKVACETCTKTN+VMVFGEITTKA VDYEKIVRDTCR+IGF S DVGLDAD+CKVLV IEQQSPDIAQGVHGHLTKRPEEIG
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPESKVACETCTKTNLVMVFGEITTKAIVDYEKIVRDTCRNIGFVSDDVGLDADNCKVLVYIEQQSPDIAQGVHGHLTKRPEEIG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK1_SOLTU (S-adenosylmethionine synthetase 1 OS=Solanum tuberosum GN=METK1 PE=2 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 1.554e-58
Identity = 108/119 (90.76%), Postives = 114/119 (95.80%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            METFLFTSESVNEGHPDKLCD++SDAVLDACL QDP+SKVACETCTKTN+VMVFGEITTKA VDYEKIVRDTCR+IGF S DVGLDAD+CKVLV IEQQSPDIAQGVHGHLTKRPEEIG
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPESKVACETCTKTNLVMVFGEITTKAIVDYEKIVRDTCRNIGFVSDDVGLDADNCKVLVYIEQQSPDIAQGVHGHLTKRPEEIG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK1_SOLLC (S-adenosylmethionine synthetase 1 OS=Solanum lycopersicum GN=SAM1 PE=2 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 1.554e-58
Identity = 108/119 (90.76%), Postives = 114/119 (95.80%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            METFLFTSESVNEGHPDKLCD++SDAVLDACL QDP+SKVACETCTKTN+VMVFGEITTKA VDYEKIVRDTCR+IGF S DVGLDAD+CKVLV IEQQSPDIAQGVHGHLTKRPEEIG
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPESKVACETCTKTNLVMVFGEITTKAIVDYEKIVRDTCRNIGFVSDDVGLDADNCKVLVYIEQQSPDIAQGVHGHLTKRPEEIG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK1_BETVU (S-adenosylmethionine synthetase 1 OS=Beta vulgaris GN=SAMS1 PE=2 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 1.554e-58
Identity = 106/119 (89.08%), Postives = 114/119 (95.80%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            ++TFLFTSESVNEGHPDK+CD++SDAVLDACLAQDP+SKVACETCTKTN+VMVFGEITTK NVDYEKIVR TCR IGF SADVGLDAD+CKVLV IEQQSPDIAQGVHGHLTKRPEEIG
Sbjct:    5 IDTFLFTSESVNEGHPDKMCDQISDAVLDACLAQDPESKVACETCTKTNLVMVFGEITTKGNVDYEKIVRQTCRDIGFVSADVGLDADNCKVLVYIEQQSPDIAQGVHGHLTKRPEEIG 123          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_MESCR (S-adenosylmethionine synthetase OS=Mesembryanthemum crystallinum GN=METK PE=2 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 2.030e-58
Identity = 107/119 (89.92%), Postives = 114/119 (95.80%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            M+TFLFTSESVNEGHPDKLCD++SDAVLDACLAQD +SKVACETCTKTN+VMVFGEITTKANVDYEKI RDTCR+IGF S DVGLDAD+CKVLV IEQQSPDIAQGVHGHLTKRPEEIG
Sbjct:    1 MDTFLFTSESVNEGHPDKLCDQISDAVLDACLAQDAESKVACETCTKTNLVMVFGEITTKANVDYEKIARDTCRNIGFVSDDVGLDADNCKVLVYIEQQSPDIAQGVHGHLTKRPEEIG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK1_ATRNU (S-adenosylmethionine synthetase 1 OS=Atriplex nummularia GN=SAMS1 PE=1 SV=2)

HSP 1 Score: 224.942 bits (572), Expect = 2.030e-58
Identity = 106/119 (89.08%), Postives = 115/119 (96.64%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            ++TFLFTSESVNEGHPDKLCD++SDAVLDACLAQDP+SKVACETCTKTN+VMVFGEITTKANVDYEKIVR TCR IGF SADVGLDAD+CKVLV IEQQSPDIAQGVHGHL++RPEEIG
Sbjct:    5 VDTFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPESKVACETCTKTNLVMVFGEITTKANVDYEKIVRQTCRDIGFVSADVGLDADNCKVLVYIEQQSPDIAQGVHGHLSRRPEEIG 123          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK4_BRAJU (S-adenosylmethionine synthetase 4 OS=Brassica juncea GN=MSAMS4 PE=2 SV=1)

HSP 1 Score: 223.016 bits (567), Expect = 7.713e-58
Identity = 106/119 (89.08%), Postives = 111/119 (93.28%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            METFLFTSESVNEGHPDKLCD+VSDA+LDACL QDP+SKVACETCTKTNMVMVFGEITT A VDYEKIVR TCR IGF SADVGLDAD C VLVNIEQQSPDIAQGVHGHLTK+PE+IG
Sbjct:    1 METFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTSAKVDYEKIVRSTCREIGFISADVGLDADKCNVLVNIEQQSPDIAQGVHGHLTKKPEDIG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK2_ATRNU (S-adenosylmethionine synthetase 2 OS=Atriplex nummularia GN=SAMS2 PE=1 SV=1)

HSP 1 Score: 223.016 bits (567), Expect = 7.713e-58
Identity = 105/119 (88.24%), Postives = 115/119 (96.64%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            ++TFLFTSESVNEGHPDKLCD++SDAVLDACLAQDP+SKVACETCTKTN+VMVFGEITTKA+VDYEKIVR TCR IGF SADVGLDAD+CKVLV IEQQSPDIAQGVHGHL++RPEEIG
Sbjct:    5 VDTFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPESKVACETCTKTNLVMVFGEITTKADVDYEKIVRQTCRDIGFVSADVGLDADNCKVLVYIEQQSPDIAQGVHGHLSRRPEEIG 123          
The following BLAST results are available for this feature:
BLAST of FC931074 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK4_ATRNU6.976e-5989.92S-adenosylmethionine synthetase 4 OS=Atriplex numm... [more]
METK1_TRIMO9.112e-5992.37S-adenosylmethionine synthetase 1 OS=Triticum mono... [more]
METK_SOLBR1.554e-5890.76S-adenosylmethionine synthetase OS=Solanum brevide... [more]
METK1_SOLTU1.554e-5890.76S-adenosylmethionine synthetase 1 OS=Solanum tuber... [more]
METK1_SOLLC1.554e-5890.76S-adenosylmethionine synthetase 1 OS=Solanum lycop... [more]
METK1_BETVU1.554e-5889.08S-adenosylmethionine synthetase 1 OS=Beta vulgaris... [more]
METK_MESCR2.030e-5889.92S-adenosylmethionine synthetase OS=Mesembryanthemu... [more]
METK1_ATRNU2.030e-5889.08S-adenosylmethionine synthetase 1 OS=Atriplex numm... [more]
METK4_BRAJU7.713e-5889.08S-adenosylmethionine synthetase 4 OS=Brassica junc... [more]
METK2_ATRNU7.713e-5888.24S-adenosylmethionine synthetase 2 OS=Atriplex numm... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B05EF PostHarvP1 Citrus clementina cDNA clone C34101B05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931074 ID=FC931074|Name=FC931074|organism=Citrus clementina|type=EST|length=560bp
GAAAAAAAACGAGAGAACTGCGAGTCGAGCTGCCGTTTTAGCGCCTCGCT
CGCTTCTCGCAGCGTATGCATATCGTGTTTCTCTCGGTCTTCTGGGTACT
GACCATTTTCGTATATCACCACCTTCAATTCCATTTGTACTCGCACCACG
GCCTCCTGCAAAGCGAAAGCTGCAGCTTCAGGTTAAATCAAATTAAAGAA
AATGGAAACATTTCTTTTCACATCAGAATCAGTGAACGAGGGTCACCCGG
ACAAGCTGTGTGACCGAGTTTCGGACGCAGTACTGGACGCGTGTTTGGCT
CAGGATCCTGACAGCAAAGTTGCTTGTGAAACATGCACAAAGACCAACAT
GGTCATGGTTTTTGGAGAAATTACAACCAAGGCCAATGTGGATTACGAGA
AAATCGTGCGTGATACATGCAGATCGATTGGGTTCACATCGGCCGATGTG
GGGCTTGATGCTGATCACTGCAAAGTTCTTGTTAATATTGAGCAGCAGAG
CCCTGACATTGCTCAGGGTGTTCATGGGCATCTCACAAAGCGGCCTGAGG
AGATTGGTGC
back to top