FC931074

Overview
NameFC931074
Unique NameFC931074
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length560
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15265 contig Ccv1_Contig15265:1..560. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK3_ARATH (S-adenosylmethionine synthetase 3 OS=Arabidopsis thaliana GN=METK3 PE=1 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 1.316e-57
Identity = 105/119 (88.24%), Postives = 111/119 (93.28%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            METFLFTSESVNEGHPDKLCD++SDA+LDACL QDP+SKVACETCTKTNMVMVFGEITT A VDYEKIVR TCR IGF SADVGLDAD C VLVNIEQQSPDIAQGVHGHLTK+PE+IG
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAILDACLEQDPESKVACETCTKTNMVMVFGEITTAAKVDYEKIVRSTCREIGFISADVGLDADKCNVLVNIEQQSPDIAQGVHGHLTKKPEDIG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK1_DAUCA (S-adenosylmethionine synthetase 1 OS=Daucus carota GN=SAMS1 PE=2 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 1.316e-57
Identity = 105/119 (88.24%), Postives = 112/119 (94.12%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            M+TFL+TSESVNEGHPDKLCD++SDAVLDACL QDPDSKVACETC+KTNMVMVFGEITTKANVDYEKIV  TCR IGF S DVGLDAD+CKVLV IEQQSPDIAQGVHGHLTKRPE+IG
Sbjct:    1 MDTFLYTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCSKTNMVMVFGEITTKANVDYEKIVHKTCRDIGFVSDDVGLDADNCKVLVQIEQQSPDIAQGVHGHLTKRPEDIG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK2_DAUCA (S-adenosylmethionine synthetase 2 OS=Daucus carota GN=SAMS2 PE=2 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 1.718e-57
Identity = 106/119 (89.08%), Postives = 112/119 (94.12%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            M+TFL TSESVNEGHPDKLCD++SDAVLDACL QDPDSKVACETC+KTNMVMVFGEITTKANVDYEKIVR TCR IGF S DVGLDAD+CKVLV IEQQSPDIAQGVHGHLTKRPE+IG
Sbjct:    1 MDTFLNTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCSKTNMVMVFGEITTKANVDYEKIVRKTCRDIGFVSDDVGLDADNCKVLVQIEQQSPDIAQGVHGHLTKRPEDIG 119          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK2_DIACA (S-adenosylmethionine synthetase 2 OS=Dianthus caryophyllus GN=SAM2 PE=2 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 2.931e-57
Identity = 105/118 (88.98%), Postives = 112/118 (94.92%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            +TFLFTSESVNEGHPDKLCD++SDAVLDACLAQD +SKVACETCTKTN+VMVFGEITTKANVDYEKIV DTCR IGF S DVGLDAD+CKVLV IEQQSPDIAQGVHGHLTKRPE+IG
Sbjct:    6 DTFLFTSESVNEGHPDKLCDQISDAVLDACLAQDAESKVACETCTKTNLVMVFGEITTKANVDYEKIVADTCREIGFVSPDVGLDADNCKVLVYIEQQSPDIAQGVHGHLTKRPEDIG 123          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK3_HORVU (S-adenosylmethionine synthetase 3 OS=Hordeum vulgare GN=SAM3 PE=2 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 3.828e-57
Identity = 107/118 (90.68%), Postives = 110/118 (93.22%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            ETFLFTSESVNEGHPDKLCD+VSDAVLDACLAQD DSKVACET TKTNMVMV GEITTKA VDYEKIVRDTCR+IGF S DVGLDAD CKVLVNIEQQSPDIAQGVHGH TKRPEE+G
Sbjct:    4 ETFLFTSESVNEGHPDKLCDQVSDAVLDACLAQDADSKVACETVTKTNMVMVLGEITTKATVDYEKIVRDTCRNIGFISDDVGLDADRCKVLVNIEQQSPDIAQGVHGHFTKRPEEVG 121          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_CHLRE (S-adenosylmethionine synthetase OS=Chlamydomonas reinhardtii GN=METM PE=3 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 1.558e-50
Identity = 96/119 (80.67%), Postives = 104/119 (87.39%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            +E+FL+TSESVNEGHPDK+CD+VSDAVLDACL QDPDSKVACETC KT MVMVFGEITTKA VDYE IVR  C+ IGFTS DVGLDAD CKVLV+IE+QSPDI QGVHG  TK  EEIG
Sbjct:    4 LESFLYTSESVNEGHPDKICDQVSDAVLDACLEQDPDSKVACETCCKTGMVMVFGEITTKAKVDYEAIVRKVCKEIGFTSEDVGLDADKCKVLVHIEEQSPDIGQGVHGMGTKALEEIG 122          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_OSTLU (S-adenosylmethionine synthetase OS=Ostreococcus lucimarinus (strain CCE9901) GN=METK-1 PE=3 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 3.361e-45
Identity = 85/116 (73.28%), Postives = 95/116 (81.90%), Query Frame = 1
Query:  211 FLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            FLFTSESVNEGHPDKL D++SD +LDACLAQDPDSKVACET TKTNMVMVFGEITTKA VDYE +VR  CR +GF S + GLD + C+VLV +  QSPDI QGVHG  TK  E+IG
Sbjct:    3 FLFTSESVNEGHPDKLADQISDGILDACLAQDPDSKVACETATKTNMVMVFGEITTKAKVDYEAVVRQVCRDVGFISDETGLDGNKCRVLVELHDQSPDIGQGVHGMGTKSDEDIG 118          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_OSTTA (S-adenosylmethionine synthetase OS=Ostreococcus tauri GN=METK PE=3 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 5.734e-45
Identity = 85/116 (73.28%), Postives = 95/116 (81.90%), Query Frame = 1
Query:  211 FLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            FLFTSESVNEGHPDKL D++SD +LDACL QDPDSKVACET TKTNMVMVFGEITTKA VDYE +VR  CR +GF S + GLD ++C+VLV +  QSPDI QGVHG  TK  EEIG
Sbjct:    3 FLFTSESVNEGHPDKLADQISDGILDACLEQDPDSKVACETATKTNMVMVFGEITTKAKVDYEAVVRQVCRDVGFISNETGLDGNNCRVLVELHDQSPDIGQGVHGMGTKSLEEIG 118          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK1_PEA (S-adenosylmethionine synthetase 1 (Fragment) OS=Pisum sativum GN=SAMS1 PE=2 SV=2)

HSP 1 Score: 174.096 bits (440), Expect = 4.109e-43
Identity = 82/92 (89.13%), Postives = 88/92 (95.65%), Query Frame = 1
Query:  283 LDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            +DACL QD DSKVACETCTKTN+VMVFGEITTKANVDYEKIVR+TCR+IGF SADVGLDAD+CKVLVNIEQQSPDIAQGVHGH TK+PEEIG
Sbjct:    3 VDACLEQDSDSKVACETCTKTNLVMVFGEITTKANVDYEKIVRNTCRNIGFVSADVGLDADNCKVLVNIEQQSPDIAQGVHGHFTKKPEEIG 94          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK3_ACTCH (S-adenosylmethionine synthetase 3 (Fragment) OS=Actinidia chinensis GN=SAM3 PE=2 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 7.749e-42
Identity = 80/86 (93.02%), Postives = 83/86 (96.51%), Query Frame = 1
Query:  301 QDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            QDPDSKVACETCTKTNMVMVFGEITTK N+DYEKIVRDTCR+IGF S DVGLDAD+CKVLVNIEQQSPDIAQGVHGHLTKRPEEIG
Sbjct:    1 QDPDSKVACETCTKTNMVMVFGEITTKGNIDYEKIVRDTCRNIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 86          
The following BLAST results are available for this feature:
BLAST of FC931074 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK3_ARATH1.316e-5788.24S-adenosylmethionine synthetase 3 OS=Arabidopsis t... [more]
METK1_DAUCA1.316e-5788.24S-adenosylmethionine synthetase 1 OS=Daucus carota... [more]
METK2_DAUCA1.718e-5789.08S-adenosylmethionine synthetase 2 OS=Daucus carota... [more]
METK2_DIACA2.931e-5788.98S-adenosylmethionine synthetase 2 OS=Dianthus cary... [more]
METK3_HORVU3.828e-5790.68S-adenosylmethionine synthetase 3 OS=Hordeum vulga... [more]
METK_CHLRE1.558e-5080.67S-adenosylmethionine synthetase OS=Chlamydomonas r... [more]
METK_OSTLU3.361e-4573.28S-adenosylmethionine synthetase OS=Ostreococcus lu... [more]
METK_OSTTA5.734e-4573.28S-adenosylmethionine synthetase OS=Ostreococcus ta... [more]
METK1_PEA4.109e-4389.13S-adenosylmethionine synthetase 1 (Fragment) OS=Pi... [more]
METK3_ACTCH7.749e-4293.02S-adenosylmethionine synthetase 3 (Fragment) OS=Ac... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B05EF PostHarvP1 Citrus clementina cDNA clone C34101B05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931074 ID=FC931074|Name=FC931074|organism=Citrus clementina|type=EST|length=560bp
GAAAAAAAACGAGAGAACTGCGAGTCGAGCTGCCGTTTTAGCGCCTCGCT
CGCTTCTCGCAGCGTATGCATATCGTGTTTCTCTCGGTCTTCTGGGTACT
GACCATTTTCGTATATCACCACCTTCAATTCCATTTGTACTCGCACCACG
GCCTCCTGCAAAGCGAAAGCTGCAGCTTCAGGTTAAATCAAATTAAAGAA
AATGGAAACATTTCTTTTCACATCAGAATCAGTGAACGAGGGTCACCCGG
ACAAGCTGTGTGACCGAGTTTCGGACGCAGTACTGGACGCGTGTTTGGCT
CAGGATCCTGACAGCAAAGTTGCTTGTGAAACATGCACAAAGACCAACAT
GGTCATGGTTTTTGGAGAAATTACAACCAAGGCCAATGTGGATTACGAGA
AAATCGTGCGTGATACATGCAGATCGATTGGGTTCACATCGGCCGATGTG
GGGCTTGATGCTGATCACTGCAAAGTTCTTGTTAATATTGAGCAGCAGAG
CCCTGACATTGCTCAGGGTGTTCATGGGCATCTCACAAAGCGGCCTGAGG
AGATTGGTGC
back to top