FC931074

Overview
NameFC931074
Unique NameFC931074
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length560
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15265 contig Ccv1_Contig15265:1..560. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK2_HUMAN (S-adenosylmethionine synthetase isoform type-2 OS=Homo sapiens GN=MAT2A PE=1 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 2.852e-36
Identity = 73/117 (62.39%), Postives = 91/117 (77.78%), Query Frame = 1
Query:  208 TFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            TFLFTSESV EGHPDK+CD++SDAVLDA L QDPD+KVACET  KT M+++ GEIT++A VDY+K+VR+  + IG+  +  G D   C VLV +EQQSPDIAQGV  HL +  E+IG
Sbjct:   17 TFLFTSESVGEGHPDKICDQISDAVLDAHLQQDPDAKVACETVAKTGMILLAGEITSRAAVDYQKVVREAVKHIGYDDSSKGFDYKTCNVLVALEQQSPDIAQGV--HLDRNEEDIG 131          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK2_MOUSE (S-adenosylmethionine synthetase isoform type-2 OS=Mus musculus GN=Mat2a PE=2 SV=2)

HSP 1 Score: 150.984 bits (380), Expect = 3.725e-36
Identity = 72/117 (61.54%), Postives = 91/117 (77.78%), Query Frame = 1
Query:  208 TFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            TFLFTSESV EGHPDK+CD++SDAVLDA L QDPD+KVACET  KT M+++ GEIT++A +DY+K+VR+  + IG+  +  G D   C VLV +EQQSPDIAQGV  HL +  E+IG
Sbjct:   17 TFLFTSESVGEGHPDKICDQISDAVLDAHLQQDPDAKVACETVAKTGMILLAGEITSRAAIDYQKVVREAIKHIGYDDSSKGFDYKTCNVLVALEQQSPDIAQGV--HLDRNEEDIG 131          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_BRAHW (S-adenosylmethionine synthetase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=metK PE=3 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 4.865e-36
Identity = 69/107 (64.49%), Postives = 86/107 (80.37%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            ++ + F+SESV EGHPDK+CD VSDAVLD CL QDP+S+VACET  KT M+M+ GEITTKA +DY+KI RDT R IG+TS+D+G DAD C V+ +I +QSPDI  GV
Sbjct:    4 IKNYYFSSESVTEGHPDKICDAVSDAVLDECLKQDPNSRVACETLAKTGMIMIAGEITTKAKLDYQKIARDTVRRIGYTSSDMGFDADTCAVMESIAEQSPDIDMGV 110          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK2_RAT (S-adenosylmethionine synthetase isoform type-2 OS=Rattus norvegicus GN=Mat2a PE=2 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 8.299e-36
Identity = 71/117 (60.68%), Postives = 91/117 (77.78%), Query Frame = 1
Query:  208 TFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            TFLFTSESV EGHPDK+CD+++DAVLDA L QDPD+KVACET  KT M+++ GEIT++A +DY+K+VR+  + IG+  +  G D   C VLV +EQQSPDIAQGV  HL +  E+IG
Sbjct:   17 TFLFTSESVGEGHPDKICDQINDAVLDAHLQQDPDAKVACETVAKTGMILLAGEITSRAAIDYQKVVREAIKHIGYDDSSKGFDYKTCNVLVALEQQSPDIAQGV--HLDRNEEDIG 131          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_LACBA (S-adenosylmethionine synthetase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=metK PE=3 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 1.849e-35
Identity = 71/113 (62.83%), Postives = 87/113 (76.99%), Query Frame = 1
Query:  205 ETFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKR 543
            E  LFTSESV+EGHPDK+ D++SDA+LDA LAQDPDS+VACET   T +V+VFGEI+TKA VD +K+VR T + IG+T    G D D+C VLV I++QSPDIAQGV   L  R
Sbjct:    3 ERHLFTSESVSEGHPDKIADQISDAILDALLAQDPDSRVACETSVTTGLVLVFGEISTKAYVDIQKVVRQTIKEIGYTDGQYGFDGDNCAVLVAIDEQSPDIAQGVDDSLETR 115          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_ANASK (S-adenosylmethionine synthetase OS=Anaeromyxobacter sp. (strain K) GN=metK PE=3 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 4.119e-35
Identity = 69/107 (64.49%), Postives = 84/107 (78.50%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            ++ FLFTSESV EGHPDK+ D++SDAVLDA L QDP  +VACET  KT  VM+ GEITTKA +DY K+ R+T R IG+TS D+G DA+ C VLV ++QQSPDI QGV
Sbjct:    3 LQDFLFTSESVTEGHPDKMADQISDAVLDAVLRQDPKGRVACETLLKTGYVMIAGEITTKARIDYPKLARETVRRIGYTSGDMGFDANTCAVLVAVDQQSPDIGQGV 109          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_ANADE (S-adenosylmethionine synthetase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=metK PE=3 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 4.119e-35
Identity = 69/107 (64.49%), Postives = 84/107 (78.50%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            ++ FLFTSESV EGHPDK+ D++SDAVLDA L QDP  +VACET  KT  VM+ GEITTKA +DY K+ R+T R IG+TS D+G DA+ C VLV ++QQSPDI QGV
Sbjct:    3 LQDFLFTSESVTEGHPDKMADQISDAVLDAVLRQDPKGRVACETLLKTGYVMIAGEITTKARIDYPKLARETVRRIGYTSGDMGFDANTCAVLVAVDQQSPDIGQGV 109          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_ANAD2 (S-adenosylmethionine synthetase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=metK PE=3 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 4.119e-35
Identity = 69/107 (64.49%), Postives = 84/107 (78.50%), Query Frame = 1
Query:  202 METFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGV 522
            ++ FLFTSESV EGHPDK+ D++SDAVLDA L QDP  +VACET  KT  VM+ GEITTKA +DY K+ R+T R IG+TS D+G DA+ C VLV ++QQSPDI QGV
Sbjct:    3 LQDFLFTSESVTEGHPDKMADQISDAVLDAVLRQDPKGRVACETLLKTGYVMIAGEITTKARIDYPKLARETVRRIGYTSGDMGFDANTCAVLVAVDQQSPDIGQGV 109          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK1_CAEEL (Probable S-adenosylmethionine synthetase 1 OS=Caenorhabditis elegans GN=sams-1 PE=2 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 4.119e-35
Identity = 73/116 (62.93%), Postives = 90/116 (77.59%), Query Frame = 1
Query:  211 FLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            FLFTSESV+EGHPDK+CD++SDAVLDA L QDP++KVACET TKT MVM+ GEIT+KA VDY+ +VR     IGFT + +G D   C VLV +EQQSP+IA GV  H+ K  E++G
Sbjct:    5 FLFTSESVSEGHPDKMCDQISDAVLDAHLKQDPNAKVACETVTKTGMVMLCGEITSKAVVDYQVLVRRVIEKIGFTDSSIGFDHKTCNVLVALEQQSPEIAAGV--HVNKDGEDVG 118          
BLAST of FC931074 vs. ExPASy Swiss-Prot
Match: METK_DROME (S-adenosylmethionine synthetase OS=Drosophila melanogaster GN=M(2)21AB PE=1 SV=2)

HSP 1 Score: 145.206 bits (365), Expect = 2.044e-34
Identity = 69/117 (58.97%), Postives = 91/117 (77.78%), Query Frame = 1
Query:  208 TFLFTSESVNEGHPDKLCDRVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFTSADVGLDADHCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG 558
            TFLFTSESV EGHPDK+CD++SDA+LDA L QDP++KVACET  KT M+++ GEIT+KA VDY+K+VR+T + IG+  +  G D   C VL+ ++QQSP+IA GV  H+ +  EEIG
Sbjct:   28 TFLFTSESVGEGHPDKMCDQISDAILDAHLKQDPNAKVACETVAKTGMILLCGEITSKAVVDYQKVVRETVQHIGYDDSSKGFDFKTCNVLLALDQQSPEIAAGV--HVNRAEEEIG 142          
The following BLAST results are available for this feature:
BLAST of FC931074 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK2_HUMAN2.852e-3662.39S-adenosylmethionine synthetase isoform type-2 OS=... [more]
METK2_MOUSE3.725e-3661.54S-adenosylmethionine synthetase isoform type-2 OS=... [more]
METK_BRAHW4.865e-3664.49S-adenosylmethionine synthetase OS=Brachyspira hyo... [more]
METK2_RAT8.299e-3660.68S-adenosylmethionine synthetase isoform type-2 OS=... [more]
METK_LACBA1.849e-3562.83S-adenosylmethionine synthetase OS=Lactobacillus b... [more]
METK_ANASK4.119e-3564.49S-adenosylmethionine synthetase OS=Anaeromyxobacte... [more]
METK_ANADE4.119e-3564.49S-adenosylmethionine synthetase OS=Anaeromyxobacte... [more]
METK_ANAD24.119e-3564.49S-adenosylmethionine synthetase OS=Anaeromyxobacte... [more]
METK1_CAEEL4.119e-3562.93Probable S-adenosylmethionine synthetase 1 OS=Caen... [more]
METK_DROME2.044e-3458.97S-adenosylmethionine synthetase OS=Drosophila mela... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B05EF PostHarvP1 Citrus clementina cDNA clone C34101B05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931074 ID=FC931074|Name=FC931074|organism=Citrus clementina|type=EST|length=560bp
GAAAAAAAACGAGAGAACTGCGAGTCGAGCTGCCGTTTTAGCGCCTCGCT
CGCTTCTCGCAGCGTATGCATATCGTGTTTCTCTCGGTCTTCTGGGTACT
GACCATTTTCGTATATCACCACCTTCAATTCCATTTGTACTCGCACCACG
GCCTCCTGCAAAGCGAAAGCTGCAGCTTCAGGTTAAATCAAATTAAAGAA
AATGGAAACATTTCTTTTCACATCAGAATCAGTGAACGAGGGTCACCCGG
ACAAGCTGTGTGACCGAGTTTCGGACGCAGTACTGGACGCGTGTTTGGCT
CAGGATCCTGACAGCAAAGTTGCTTGTGAAACATGCACAAAGACCAACAT
GGTCATGGTTTTTGGAGAAATTACAACCAAGGCCAATGTGGATTACGAGA
AAATCGTGCGTGATACATGCAGATCGATTGGGTTCACATCGGCCGATGTG
GGGCTTGATGCTGATCACTGCAAAGTTCTTGTTAATATTGAGCAGCAGAG
CCCTGACATTGCTCAGGGTGTTCATGGGCATCTCACAAAGCGGCCTGAGG
AGATTGGTGC
back to top