FC931076

Overview
NameFC931076
Unique NameFC931076
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length704
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC931076_ssr18 microsatellite FC931076_ssr18:18..33. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig14439 contig Ccv1_Contig14439:7..710. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931076 vs. ExPASy Swiss-Prot
Match: SAP10_ARATH (Zinc finger A20 and AN1 domain-containing stress-associated protein 10 OS=Arabidopsis thaliana GN=SAP10 PE=2 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 9.395e-18
Identity = 49/149 (32.89%), Postives = 72/149 (48.32%), Query Frame = 3
Query:  258 CINNCGFFGSVATMNMCSKCYKDIMLKQDQAKLAASSIGSIVNETSSSNGSESVAAATVDVQASSVEPKIISVQPSCASELSESVEAKPKEGPSRCSSCKKRVGLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKSNPVIKA 704
            C   CG +G+    N+CS CYK  +L+   A                                   EP+    Q  C    S +VE +P +   RC  CK++VG+ GFKCRCG+++C SHRY ++H+CPFDY+ + R A+    P+I+A
Sbjct:   10 CEGGCGLYGTRVNNNLCSLCYKKSVLQHSPAL--------------------------------RFEPETEQSQ-CCPPTNSPAVEEEPVK-KRRCGICKRKVGMLGFKCRCGHMFCGSHRYPEEHSCPFDYKQSGRLALATQLPLIRA 124          
BLAST of FC931076 vs. ExPASy Swiss-Prot
Match: SAP15_ORYSJ (Zinc finger AN1 domain-containing stress-associated protein 15 OS=Oryza sativa subsp. japonica GN=SAP15 PE=2 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 7.953e-17
Identity = 34/56 (60.71%), Postives = 46/56 (82.14%), Query Frame = 3
Query:  537 SRCSSCKKRVGLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKSNPVIKA 704
            +RC+ C+KRVGLTGF+CRCG L+C  HR+S+ H C FDY+TA R+ I ++NPVI+A
Sbjct:  113 NRCNVCRKRVGLTGFRCRCGELFCPRHRHSETHECSFDYKTAGREEIARANPVIRA 168          
BLAST of FC931076 vs. ExPASy Swiss-Prot
Match: SAP14_ORYSJ (Zinc finger AN1 domain-containing stress-associated protein 14 OS=Oryza sativa subsp. japonica GN=SAP14 PE=2 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 3.022e-16
Identity = 35/72 (48.61%), Postives = 50/72 (69.44%), Query Frame = 3
Query:  489 ASELSESVEAKPKEGPSRCSSCKKRVGLTGFKCRCGNLYCVSHRYSDKHNCPFDYRTAARDAIIKSNPVIKA 704
            AS  S S     +   +RC++C+++VGLTGFKCRCG  +C  HRY+D+H C FDY+++ R+ I K NPV+ A
Sbjct:  159 ASYSSSSPATGEQPEANRCATCRRKVGLTGFKCRCGGTFCGGHRYADEHGCGFDYKSSGRELIAKQNPVVVA 230          
BLAST of FC931076 vs. ExPASy Swiss-Prot
Match: ZFAN3_RAT (AN1-type zinc finger protein 3 OS=Rattus norvegicus GN=Zfand3 PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.027e-12
Identity = 52/197 (26.40%), Postives = 77/197 (39.09%), Query Frame = 3
Query:  237 PPEGPILCINNCGFFGSVATMNMCSKCYKDIMLKQDQAKLAASSIGS----IVNETSSSNGSESVAAATVDVQASSVEPKIISVQP----------------------SCASELSESVEAKPKEGP--------------------SRCSSCKKRVGLTGFK---CRCGNLYCVSHRYSDKHNCPFDYRTAARDAII 680
            PP  P      CGF+GS  TMN+CSKC+ D   KQ       S+  S       ET+S N + SV   T+     S+  ++    P                      SC ++     EA P + P                     RC  C+ ++ L   +   CRCG ++C+ HR  ++H+C FD+    R+  I
Sbjct:   15 PPRCP------CGFWGSSKTMNLCSKCFADFQKKQPDDDSTPSTSNSQSDLFSEETTSDNNNTSVTTPTLSPSQQSLPTELNVTSPSEEECGPCTDTAHVSLITPTKRSCGADSQSESEASPVKRPRLVENPERPEESGRSKQKSRRRCFQCQTKLELVQQELGSCRCGYVFCMLHRLPEQHDCTFDHMGRGREEAI 205          
BLAST of FC931076 vs. ExPASy Swiss-Prot
Match: ZFAN3_MOUSE (AN1-type zinc finger protein 3 OS=Mus musculus GN=Zfand3 PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.648e-12
Identity = 52/197 (26.40%), Postives = 77/197 (39.09%), Query Frame = 3
Query:  237 PPEGPILCINNCGFFGSVATMNMCSKCYKDIMLKQDQAKLAASSIGS----IVNETSSSNGSESVAAATVDVQASSVEPKIISVQP----------------------SCASELSESVEAKPKEGP--------------------SRCSSCKKRVGLTGFK---CRCGNLYCVSHRYSDKHNCPFDYRTAARDAII 680
            PP  P      CGF+GS  TMN+CSKC+ D   KQ       S+  S       ET+S N + SV   T+     S+  ++    P                      SC ++     EA P + P                     RC  C+ ++ L   +   CRCG ++C+ HR  ++H+C FD+    R+  I
Sbjct:   15 PPRCP------CGFWGSSKTMNLCSKCFADFQKKQPDDDSTPSTSNSQSDLFSEETTSDNNNTSVTTPTLSPSQQSLPTELNVTSPSTEECGPCTDTAHVSLITPTKRSCGADSQSENEASPVKRPRLVENPERPEESGRSKQKSRRRCFQCQTKLELVQQELGSCRCGYVFCMLHRLPEQHDCTFDHMGRGREEAI 205          
BLAST of FC931076 vs. ExPASy Swiss-Prot
Match: ZFAN3_HUMAN (AN1-type zinc finger protein 3 OS=Homo sapiens GN=ZFAND3 PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 4.516e-12
Identity = 51/197 (25.89%), Postives = 77/197 (39.09%), Query Frame = 3
Query:  237 PPEGPILCINNCGFFGSVATMNMCSKCYKDIMLKQDQAKLAASSIGS----IVNETSSSNGSESVAAATVDVQASSVEPKIISVQP----------------------SCASELSESVEAKPKEGP--------------------SRCSSCKKRVGLTGFK---CRCGNLYCVSHRYSDKHNCPFDYRTAARDAII 680
            PP  P      CGF+GS  TMN+CSKC+ D   KQ     A S+  S       ET+S N + S+   T+      +  ++    P                      SC ++     EA P + P                     RC  C+ ++ L   +   CRCG ++C+ HR  ++H+C FD+    R+  I
Sbjct:   15 PPRCP------CGFWGSSKTMNLCSKCFADFQKKQPDDDSAPSTSNSQSDLFSEETTSDNNNTSITTPTLSPSQQPLPTELNVTSPSKEECGPCTDTAHVSLITPTKRSCGTDSQSENEASPVKRPRLLENTERSEETSRSKQKSRRRCFQCQTKLELVQQELGSCRCGYVFCMLHRLPEQHDCTFDHMGRGREEAI 205          
BLAST of FC931076 vs. ExPASy Swiss-Prot
Match: ZFAN3_XENLA (AN1-type zinc finger protein 3 homolog OS=Xenopus laevis GN=zfand3 PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.006e-11
Identity = 54/196 (27.55%), Postives = 79/196 (40.31%), Query Frame = 3
Query:  237 PPEGPILCINNCGFFGSVATMNMCSKCYKDIMLKQDQAKLAASSIGS----IVNETSSSNGSESVAAATVD-VQASSVEPKIIS--------------------VQPSCASELSESVEAKPKEGP--------------------SRCSSCKKRVGLTGFK---CRCGNLYCVSHRYSDKHNCPFDYRTAARDAII 680
            PP  P      CGF+GS  TMN+CSKC+ D   KQ     A S+  S      +ET S NG+ S+   TV+  Q    E  + S                     + SC S+     +  P + P                     RC  C+ ++ L   +   CRCG ++C+ HR  ++H+C FD+    R+  I
Sbjct:   15 PPRCP------CGFWGSSKTMNLCSKCFADFQKKQPDEDTAPSTSSSQSDLFPSETDSDNGNTSIPTPTVNPTQQLPTELNVDSPSKEDCGPCTDSAHVSLTTPSKRSCDSDSQSEDDTSPMKRPRLLDSGDRPDNSSRSKQKSRRRCFRCQIKLELVQQELGSCRCGYVFCMLHRLPEQHDCTFDHMGRGREEAI 204          
The following BLAST results are available for this feature:
BLAST of FC931076 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 37
Match NameE-valueIdentityDescription
SAP10_ARATH9.395e-1832.89Zinc finger A20 and AN1 domain-containing stress-a... [more]
SAP15_ORYSJ7.953e-1760.71Zinc finger AN1 domain-containing stress-associate... [more]
SAP14_ORYSJ3.022e-1648.61Zinc finger AN1 domain-containing stress-associate... [more]
ZFAN3_RAT2.027e-1226.40AN1-type zinc finger protein 3 OS=Rattus norvegicu... [more]
ZFAN3_MOUSE2.648e-1226.40AN1-type zinc finger protein 3 OS=Mus musculus GN=... [more]
ZFAN3_HUMAN4.516e-1225.89AN1-type zinc finger protein 3 OS=Homo sapiens GN=... [more]
ZFAN3_XENLA1.006e-1127.55AN1-type zinc finger protein 3 homolog OS=Xenopus ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B08EF PostHarvP1 Citrus clementina cDNA clone C34101B08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931076 ID=FC931076|Name=FC931076|organism=Citrus clementina|type=EST|length=704bp
TTTTTAAAAAAAATCACAGAGAGAGAGAGAGAGACACCCGGAAAGGGAAA
CGAGGACGTCTCTCATCGGTTTTTGCCTGCTCTCTCCCCGATAGGCCGAT
CTGGTCCATTTAATTTTAGGGGCTCATTGGATGCTGGCTTGAGCTCGGGG
ATCGGCTTAAGGGATTCATTGCTGTTTCTTCTGTTGCTCGCAGGGGTGGT
GAAAACATGGACCATGATGAGACTGGATGCCAAGCTCCTCCTGAGGGCCC
TATCTTGTGCATCAACAATTGTGGTTTCTTTGGAAGTGTGGCTACTATGA
ATATGTGTTCCAAATGCTACAAGGATATAATGCTGAAACAGGATCAAGCT
AAGCTTGCTGCTTCATCTATTGGAAGCATTGTGAATGAAACGTCAAGCAG
CAATGGAAGTGAATCTGTTGCTGCTGCCACTGTTGATGTGCAAGCTAGTT
CAGTGGAGCCAAAAATCATCTCTGTGCAGCCATCATGTGCTTCAGAATTG
AGCGAGAGTGTGGAGGCAAAGCCGAAGGAGGGTCCCAGCCGGTGCAGCAG
TTGCAAGAAGCGTGTTGGTTTAACAGGATTCAAATGTCGCTGTGGTAACT
TATACTGTGTGTCACATCGCTATTCGGACAAACATAACTGCCCCTTTGAC
TACCGCACTGCTGCTAGGGATGCTATAATTAAAAGCAACCCTGTGATCAA
GGCT
back to top