FC931077

Overview
NameFC931077
Unique NameFC931077
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length704
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15266 contig Ccv1_Contig15266:1..704. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: TCMO_ARATH (Trans-cinnamate 4-monooxygenase OS=Arabidopsis thaliana GN=CYP73A5 PE=2 SV=1)

HSP 1 Score: 424.861 bits (1091), Expect = 2.101e-118
Identity = 203/234 (86.75%), Postives = 219/234 (93.59%), Query Frame = 2
Query:    2 LMMYNNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            LMMYNNM+RIMFDRRFES+DDPLF RLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKIC++VK+RR+ LFK YFV+ERK++AS+K   +E LKCAIDHIL+A+ KGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQ KLRNELDTVLGPG Q+TEPD HKLPYLQAV+KETLRLRMAIPLLVPHMNLHDAKL GYD+PAESKILVNAWWLAN P  WKKP
Sbjct:  180 LMMYNNMFRIMFDRRFESEDDPLFLRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICQDVKDRRIALFKKYFVDERKQIASSKPTGSEGLKCAIDHILEAEQKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQSKLRNELDTVLGPGVQVTEPDLHKLPYLQAVVKETLRLRMAIPLLVPHMNLHDAKLAGYDIPAESKILVNAWWLANNPNSWKKP 413          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: TCMO_HELTU (Trans-cinnamate 4-monooxygenase OS=Helianthus tuberosus GN=CYP73A1 PE=1 SV=1)

HSP 1 Score: 422.935 bits (1086), Expect = 7.986e-118
Identity = 202/234 (86.32%), Postives = 217/234 (92.74%), Query Frame = 2
Query:    2 LMMYNNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            LMMYNNM+RIMFDRRFES+DDPLF +LKALNGERSRLAQSFEYNYGDFIPILRPFLR YLK+CKEVK++R+QLFKDYFV+ERKK+ STK M N  LKCAIDHIL+A+ KGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQ KLR+ELDT LGPG QITEPD   LPYLQAV+KETLRLRMAIPLLVPHMNLHDAKLGG+D+PAESKILVNAWWLAN P  WKKP
Sbjct:  180 LMMYNNMFRIMFDRRFESEDDPLFLKLKALNGERSRLAQSFEYNYGDFIPILRPFLRNYLKLCKEVKDKRIQLFKDYFVDERKKIGSTKKMDNNQLKCAIDHILEAKEKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQAKLRHELDTKLGPGVQITEPDVQNLPYLQAVVKETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPDQWKKP 413          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: TCMO_MEDSA (Trans-cinnamate 4-monooxygenase OS=Medicago sativa GN=CYP73A3 PE=2 SV=1)

HSP 1 Score: 420.624 bits (1080), Expect = 3.963e-117
Identity = 203/235 (86.38%), Postives = 218/235 (92.77%), Query Frame = 2
Query:    2 LMMYNNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSM-SNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            LMMYN MYRIMFDRRFES++DPLF +LKALNGERSRLAQSFEYNYGDFIPILRPFL+GYLK+CKEVK+RRLQLFKDYFV+ERKKL STKS  SN+ LKCAIDHILDAQ KGEIN+DNVLYIVENINVAAIETTLWSIEWGIAELVNH +IQ K+R E+D VLGPGHQ+TEPD HKLPYLQAVIKETLRLRMAIPLLVPHMNLHD KL G+D+PAESKILVNAWWL N PA WKKP
Sbjct:  180 LMMYNIMYRIMFDRRFESEEDPLFVKLKALNGERSRLAQSFEYNYGDFIPILRPFLKGYLKVCKEVKDRRLQLFKDYFVDERKKLESTKSTTSNDGLKCAIDHILDAQKKGEINDDNVLYIVENINVAAIETTLWSIEWGIAELVNHQDIQNKVREEMDRVLGPGHQVTEPDLHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDPKLNGFDIPAESKILVNAWWLPNNPAHWKKP 414          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: TCMO_PETCR (Trans-cinnamate 4-monooxygenase OS=Petroselinum crispum GN=CYP73A10 PE=2 SV=1)

HSP 1 Score: 414.461 bits (1064), Expect = 2.840e-115
Identity = 200/234 (85.47%), Postives = 217/234 (92.74%), Query Frame = 2
Query:    2 LMMYNNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            L+MYNNMYRIMFDRRFES DDPLF +LKALNGERSRLAQSFEY++GDFIPILRPFLRGYLK+C+E+K++RL+LFKDYFV+ERKKL S KS+ N SLKCAIDHI++AQ KGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVN+PEIQKKLR+ELDTVLG G QI EPD  KLPYLQAVIKETLR RMAIPLLVPHMNLHDAKL GYD+PAESKILVNAWWLAN PA W KP
Sbjct:  181 LLMYNNMYRIMFDRRFESVDDPLFLKLKALNGERSRLAQSFEYHFGDFIPILRPFLRGYLKLCQEIKDKRLKLFKDYFVDERKKLESIKSVDNNSLKCAIDHIIEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNNPEIQKKLRHELDTVLGAGVQICEPDVQKLPYLQAVIKETLRYRMAIPLLVPHMNLHDAKLAGYDIPAESKILVNAWWLANNPAHWNKP 414          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C98A1_SORBI (Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1 PE=2 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 2.156e-30
Identity = 76/237 (32.07%), Postives = 128/237 (54.01%), Query Frame = 2
Query:    2 LMMYNNMYRIMFDRRFESQD---DPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            ++ +NN+ R+ F +RF + +   D      K +     ++  S   +  +FI  LR       ++ K   ERR +L      E  K L  + +  +      +D +   + + +++ED V+ ++ ++  A ++TT+ S+EW +AELV +P +QKKL+ ELD V+G    + E D   LPYLQAV+KE+LRL    PL++PH    + K+GGYD+P  + ++VN W +A  P  W  P
Sbjct:  180 MVAFNNITRLAFGKRFMNANGDIDEQGREFKTIVNNGIKIGASL--SVAEFIWYLRWLCPLNEELYKTHNERRDRLTMKIIEEHAKSLKESGAKQH-----FVDALFTLKQQYDLSEDTVIGLLWDMITAGMDTTVISVEWAMAELVRNPRVQKKLQEELDRVVGRDRVMLETDFQNLPYLQAVVKESLRLHPPTPLMLPHKASTNVKIGGYDIPKGANVMVNVWAVARDPKVWSNP 409          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C98A2_SOYBN (Cytochrome P450 98A2 OS=Glycine max GN=CYP98A2 PE=2 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 1.397e-29
Identity = 78/240 (32.50%), Postives = 125/240 (52.08%), Query Frame = 2
Query:    2 LMMYNNMYRIMFDRRFESQDDPLFNR---LKALNGERSRLAQSFEYNYGDFIPILR---PFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            ++ +NN+ R+ F +RF + +  +  +    KA+     +L  S      + IP LR   P   G        ++R  +       E RKK    K          +D +L  Q K +++ED ++ ++ ++  A ++TT  S+EW +AEL+ +P +Q+K++ ELD V+G    +TE D   LPYLQ V KE +RL    PL++PH    + K+GGYD+P  S + VN W +A  PA WK P
Sbjct:  177 VVAFNNITRLAFGKRFVNSEGVMDEQGVEFKAIVENGLKLGASLAM--AEHIPWLRWMFPLEEGAFAKHGARRDRLTRAIMAEHTEARKKSGGAKQHF-------VDALLTLQDKYDLSEDTIIGLLWDMITAGMDTTAISVEWAMAELIRNPRVQQKVQEELDRVIGLERVMTEADFSNLPYLQCVTKEAMRLHPPTPLMLPHRANANVKVGGYDIPKGSNVHVNVWAVARDPAVWKDP 407          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C98A3_ARATH (Cytochrome P450 98A3 OS=Arabidopsis thaliana GN=CYP98A3 PE=1 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 1.825e-29
Identity = 77/234 (32.91%), Postives = 128/234 (54.70%), Query Frame = 2
Query:   11 YNNMYRIMFDRRFESQD---DPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            +NN+ R+ F +RF + +   D      KA+     +L  S   +  + IP LR       K   E   RR +L +   + E   LA  KS   +  +  +D +L  + + +++ED ++ ++ ++  A ++TT  + EW +AE++ +P +Q+K++ E D V+G    +TE D  +LPYLQ V+KE+ RL    PL++PH +  D K+GGYD+P  S + VN W +A  PA WK P
Sbjct:  179 FNNITRLAFGKRFMNAEGVVDEQGLEFKAIVSNGLKLGASL--SIAEHIPWLRWMFPADEKAFAEHGARRDRLTRA--IMEEHTLARQKSSGAK--QHFVDALLTLKDQYDLSEDTIIGLLWDMITAGMDTTAITAEWAMAEMIKNPRVQQKVQEEFDRVVGLDRILTEADFSRLPYLQCVVKESFRLHPPTPLMLPHRSNADVKIGGYDIPKGSNVHVNVWAVARDPAVWKNP 406          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C93A1_SOYBN (Cytochrome P450 93A1 OS=Glycine max GN=CYP93A1 PE=2 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 9.057e-29
Identity = 77/241 (31.95%), Postives = 130/241 (53.94%), Query Frame = 2
Query:    2 LMMYNNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPF-LRGYLKICKEVKERRLQLFKDYFVEERK------KLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            + + NN+   M   +  S++D     +K L    + L   F  N  DFI  L+PF L+G+ +  KE ++R   +  D  +++R+      K   T     + L   +D   D   + ++++ N+   + +I VA  +T+  SIEW +AEL+N+P++ +K R E+D V+G    + E D   LPYLQA+++ETLRL    PL+V   +   A + GYD+PA++++ VN W +   P  W+KP
Sbjct:  176 MTLSNNIVSRMTLSQKTSENDNQAEEMKKLVSNIAELMGKF--NVSDFIWYLKPFDLQGFNRKIKETRDR-FDVVVDGIIKQRQEERRKNKETGTAKQFKDMLDVLLDMHEDENAEIKLDKKNIKAFIMDIFVAGTDTSAVSIEWAMAELINNPDVLEKARQEIDAVVGKSRMVEESDIANLPYLQAIVRETLRLHPGGPLVVRESS-KSAVVCGYDIPAKTRLFVNVWAIGRDPNHWEKP 412          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C76A1_SOLME (Cytochrome P450 76A1 (Fragment) OS=Solanum melongena GN=CYP76A1 PE=2 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 2.635e-28
Identity = 69/200 (34.50%), Postives = 109/200 (54.50%), Query Frame = 2
Query:  131 NYGDFIPILRPF-LRGYLKICKEVKERRLQLFKDYF---VEERKKLASTKSMSNESLKCAIDHILDAQTKGE-----INEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N  D  P L+ F ++G  K  +    +  ++ K +    +EERKK        N S+K  +D ++D +  G+     ++ED +  I+  + +A  ETT  S+EW + EL+ HP+   K++ E+  V+GP  +  E D   LPY+QAV+KE LRL   +PLL+P   + D K  GYD+P  +++LVNAW +   P  W  P
Sbjct:  184 NISDIFPCLKMFDVQGLRKKMERDMGKGKEITKKFIEERIEERKK-----GEKNRSIKDLLDVLIDFEGSGKDEPDKLSEDEITVIILEMFLAGTETTSSSVEWALTELLRHPQAMAKVKLEILQVIGPNKKFEECDIDSLPYMQAVLKEQLRLHPPLPLLIPRKAIQDTKFMGYDIPKGTQVLVNAWAIGRDPEYWDNP 378          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C81D1_ARATH (Cytochrome P450 81D1 OS=Arabidopsis thaliana GN=CYP81D1 PE=2 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 4.970e-27
Identity = 80/238 (33.61%), Postives = 125/238 (52.52%), Query Frame = 2
Query:    5 MMYNNMYRIMFDRRF---ESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKG-EINEDNVLY-IVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            + +NN+ R+M  +R+   E+ D+    R++ L  +    A +   N  D++PILR F   Y    K++ E       D F++    L   K    E+    IDH+L  Q    E   D ++  I+  + +A   T+  ++EW ++ L+NHP++  K R+E+D  +G    I E D  +LPYL+ ++ ETLRL  A PLLVPHM   D K+G YD+P  + +LVNAW +   P  W  P
Sbjct:  187 LTFNNIMRMMTGKRYYGEETTDEEEAKRVRKLVADVG--ANTSSGNAVDYVPILRLF-SSYENRVKKLGEET-----DKFLQG---LIDDKRGQQETGTTMIDHLLVLQKSDIEYYTDQIIKGIILIMVIAGTNTSAVTLEWALSNLLNHPDVISKARDEIDNRVGLDRLIEEADLSELPYLKNIVLETLRLHPATPLLVPHMASEDCKIGSYDMPRGTTLLVNAWAIHRDPNTWDDP 413          
The following BLAST results are available for this feature:
BLAST of FC931077 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 311
Match NameE-valueIdentityDescription
TCMO_ARATH2.101e-11886.75Trans-cinnamate 4-monooxygenase OS=Arabidopsis tha... [more]
TCMO_HELTU7.986e-11886.32Trans-cinnamate 4-monooxygenase OS=Helianthus tube... [more]
TCMO_MEDSA3.963e-11786.38Trans-cinnamate 4-monooxygenase OS=Medicago sativa... [more]
TCMO_PETCR2.840e-11585.47Trans-cinnamate 4-monooxygenase OS=Petroselinum cr... [more]
C98A1_SORBI2.156e-3032.07Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1... [more]
C98A2_SOYBN1.397e-2932.50Cytochrome P450 98A2 OS=Glycine max GN=CYP98A2 PE=... [more]
C98A3_ARATH1.825e-2932.91Cytochrome P450 98A3 OS=Arabidopsis thaliana GN=CY... [more]
C93A1_SOYBN9.057e-2931.95Cytochrome P450 93A1 OS=Glycine max GN=CYP93A1 PE=... [more]
C76A1_SOLME2.635e-2834.50Cytochrome P450 76A1 (Fragment) OS=Solanum melonge... [more]
C81D1_ARATH4.970e-2733.61Cytochrome P450 81D1 OS=Arabidopsis thaliana GN=CY... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B09EF PostHarvP1 Citrus clementina cDNA clone C34101B09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931077 ID=FC931077|Name=FC931077|organism=Citrus clementina|type=EST|length=704bp
GCTTATGATGTACAACAACATGTACAGGATTATGTTTGATAGAAGATTCG
AGAGTCAGGATGATCCTTTGTTTAACAGATTAAAGGCTTTGAATGGTGAG
AGGAGTCGGTTGGCCCAGAGCTTTGAGTACAATTACGGTGATTTTATTCC
CATTTTGAGACCTTTCTTGAGAGGCTACTTGAAGATTTGTAAGGAAGTTA
AAGAAAGGAGACTCCAGCTCTTCAAGGACTACTTTGTTGAGGAGAGAAAG
AAATTGGCAAGCACGAAGAGCATGAGTAATGAAAGCTTGAAATGCGCAAT
CGATCATATTTTGGACGCTCAGACAAAGGGAGAAATCAACGAGGACAACG
TTCTATACATCGTTGAGAACATCAATGTTGCCGCGATCGAGACAACTCTT
TGGTCGATCGAGTGGGGAATTGCAGAGCTAGTGAATCATCCTGAAATCCA
GAAGAAGCTCCGCAATGAACTTGACACCGTGCTTGGTCCTGGTCATCAAA
TCACTGAGCCTGACACCCACAAACTACCCTACCTTCAGGCCGTGATCAAG
GAAACTCTTCGCCTTAGGATGGCAATTCCTCTTCTTGTGCCGCACATGAA
CCTTCACGACGCCAAGCTTGGAGGCTACGACGTCCCTGCTGAGAGCAAAA
TCCTAGTGAACGCGTGGTGGCTCGCCAACNATCCCGCCCCATGGAAGAAA
CCTG
back to top