FC931077

Overview
NameFC931077
Unique NameFC931077
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length704
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15266 contig Ccv1_Contig15266:1..704. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C75A2_SOLME (Flavonoid 3',5'-hydroxylase OS=Solanum melongena GN=CYP75A2 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.449e-18
Identity = 64/236 (27.12%), Postives = 110/236 (46.61%), Query Frame = 2
Query:    8 MYNNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIP-ILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGE---INEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            M N + ++M  +R   +     N  K +  E   +A  F  N GDFIP I    L+G  K  K++ ++   L    F E        K   +      +D I+  +   E   ++  N+  ++ N+  A  +T+   IEW + E++ +P I KK + E+D ++G   +  E D   LPYL+A+ KE  R   + PL +P ++     + GY +P  +++ VN W +   P  W+ P
Sbjct:  183 MANMIGQVMLSKRVFVEKGKEVNEFKNMVVELMTVAGYF--NIGDFIPQIAWMDLQGIEKGMKKLHKKFDDLLTKMFEEHEATSNERKGKPD-----FLDFIMANRDNSEGERLSITNIKALLLNLFTAGTDTSSSVIEWALTEMMKNPTIFKKAQQEMDQIIGKNRRFIESDIPNLPYLRAICKEAFRKHPSTPLNLPRVSSDACTIDGYYIPKNTRLSVNIWAIGRDPDVWENP 411          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71BK_ARATH (Cytochrome P450 71B20 OS=Arabidopsis thaliana GN=CYP71B20 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.449e-18
Identity = 54/142 (38.03%), Postives = 81/142 (57.04%), Query Frame = 2
Query:  299 IDHILDAQTKG------EINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGH-QITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            ID +LDA  K       E+  D++   + NI +A I+T   ++ W + ELV +P++ KK++ E+   LG    +ITE D  K+PYL+ VIKET RL  A PL++P   +   K+ GYD+P + +ILVN   +   P  W  P
Sbjct:  271 IDSMLDAIHKEGKDSSLELIIDHIKGFLANIFLAGIDTGALTMIWAMTELVKNPKLIKKVQGEIREQLGSNKARITEEDIDKVPYLKMVIKETFRLHPAAPLILPRETMAHIKVQGYDIPPKRRILVNVSAIGRDPKLWTNP 412          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71BG_ARATH (Cytochrome P450 71B16 OS=Arabidopsis thaliana GN=CYP71B16 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.449e-18
Identity = 52/147 (35.37%), Postives = 78/147 (53.06%), Query Frame = 2
Query:  266 KSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQ-ITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            K   ++SL+  IDHI     KG          + NI +A I+T   ++ W + EL  +PE+ K ++ E+    G   + IT+ D +K+P+L  VIKET RL    PLL+P   +   K+ GYD+P + +ILVN W +   P  W  P
Sbjct:  280 KQGKDDSLRLTIDHI-----KG---------FLTNIIIAGIDTGALTMIWAMTELARNPELMKNVQGEIRDSFGNNKERITKEDLNKVPFLNMVIKETFRLHPVAPLLLPRETMTHIKVQGYDIPPKRRILVNTWAIGRDPTLWINP 412          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71AI_ARATH (Cytochrome P450 71A18 OS=Arabidopsis thaliana GN=CYP71A18 PE=2 SV=2)

HSP 1 Score: 93.2041 bits (230), Expect = 1.449e-18
Identity = 41/122 (33.61%), Postives = 76/122 (62.30%), Query Frame = 2
Query:  332 EINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGP-GHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPW 694
            ++  +++ +++ ++ +  I T+   +EW + EL+ +PE  KKL+NE+ + + P G  I E +   + YL+AVIKE  R+   +PL++P +   D K+ GYD+ A +++L+NAW +   PA W
Sbjct:  282 KVQRNDIKFMILDMFIGGISTSSTLLEWIMTELIRNPECMKKLQNEIRSTIRPHGSYIKEKEVENMRYLKAVIKEVFRVHPPLPLILPRLLTEDVKVKGYDIAAGTEVLINAWSIHRDPAIW 403          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71A2_SOLME (Cytochrome P450 71A2 OS=Solanum melongena GN=CYP71A2 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.449e-18
Identity = 64/203 (31.53%), Postives = 108/203 (53.20%), Query Frame = 2
Query:  128 YNYGDFIPILRPFLRGYLKICKEVKE--RRLQLFKDYFVEE---RKKLASTKSMSNESLKCAIDHILDAQTKGE----INEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLR-MAIPLLVPHMNLHDAK-LGGYDVPAESKILVNAWWLANXPAPWKKP 703
            +N GD+IP L  ++  +  +  +VK+  + L +F +  +EE   RKK    +  S    K  +D +L+ Q   E    +  D++  I+ +   A  +TT  +++W +AEL+  P   K L++E+  +     +ITE D   + YL+AVIKE+LRL      LLVP  ++ D   LG Y +PA ++ ++NAW +   P  W+ P
Sbjct:  217 FNVGDYIPRLE-WVNKFTGLDAKVKKVAKELDMFLEIVIEEHIIRKK--KEEYTSTGEAKDFVDVLLEIQNGNETDFPLQRDSLKAILLDSFAAGTDTTFATLDWTMAELLRQPRALKTLQDEVRGLAQGKSEITEDDLKNMQYLRAVIKESLRLHPTQESLLVPRESMEDVNLLGYYHIPARTQAIINAWAIGRDPLSWENP 416          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP1A2_MACFU (Cytochrome P450 1A2 OS=Macaca fuscata fuscata GN=CYP1A2 PE=2 SV=3)

HSP 1 Score: 92.8189 bits (229), Expect = 1.893e-18
Identity = 66/234 (28.21%), Postives = 102/234 (43.59%), Query Frame = 2
Query:   35 FDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLAST-----KSMSNESLKCAIDHILDAQTKGE------INEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            F + F    D + + +K        +  +   N  DF PILR     YL          LQ FK +    R+ L  T     +     S++     +     KG       I ++ ++ +V +I  A  +T   +I W +  LV  PEIQ+K++ ELD V+G G +    D  +LPYL+A I ET R    +P  +PH    D  L G+ +P E  + +N W + + P  W  P
Sbjct:  205 FGQHFPESSDEMLSLVK---NSHEFVESASSGNPVDFFPILR-----YLP------NPALQRFKAFNQRFRRFLQKTVQEHYQDFDKNSVQDITGALFKHSKKGPRASGNLIPQEKIVNLVNDIFGAEFDTIATAISWSLMYLVTKPEIQRKIQKELDAVIGRGRRPRLSDRPQLPYLEAFILETFRHSSFVPFTIPHSTTRDTTLNGFYIPRECCVFINQWQVNHDPQLWGDP 424          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP1A1_ONCMY (Cytochrome P450 1A1 OS=Oncorhynchus mykiss GN=cyp1a1 PE=2 SV=2)

HSP 1 Score: 92.8189 bits (229), Expect = 1.893e-18
Identity = 64/227 (28.19%), Postives = 105/227 (46.26%), Query Frame = 2
Query:   35 FDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHI----LDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            F RR+   D  L   L  ++ E  ++  S   N  DFIPILR      +K   ++ +R    F    V E  + +  K    +     IDH     LD     +++++ ++ IV ++  A  +T   ++ W +  LV +PEIQ++L  EL   +G        D   LP L+A I E  R    +P  +PH  + D  L GY +P ++ + +N W + + P  WK+P
Sbjct:  208 FGRRYSHDDQELLG-LVNMSDEFGQVVGSG--NPADFIPILRYLPNRTMKRFMDINDR-FNNFVQKIVSEHYE-SYDKDNIRDITDSLIDHCEDRKLDENANIQVSDEKIVGIVNDLFGAGFDTISTALSWAVVYLVAYPEIQERLHQELKEKVGMIRTPRLSDKINLPLLEAFILEIFRHSSFLPFTIPHCTIKDTSLNGYFIPKDTCVFINQWQVNHDPELWKEP 429          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP1A1_LIZAU (Cytochrome P450 1A1 OS=Liza aurata GN=cyp1a1 PE=2 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.893e-18
Identity = 60/225 (26.67%), Postives = 107/225 (47.56%), Query Frame = 2
Query:   35 FDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLA--STKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            F RR++  D  L + L  L+ E  ++  S   N  DFIPIL+      +K    + +R +   +    E        + + +++  +    D  LD     +++++ V+ IV ++  A ++T   ++ W +  LV +PEIQ++L  EL   +G        D + LP L+A I E  R    +P  +PH    D  L GY +P ++ + +N W + + P  WK+P
Sbjct:  208 FGRRYDHHDRELLS-LVNLSDEFGQVVGSG--NPADFIPILQYLPNKTMKKFVNINDRFISFVQKIVSEHYATFNKDNIRDITDSLIDHCEDRKLDENANVQMSDEKVVGIVNDLFGAGLDTISTALSWSVMYLVAYPEIQERLYQELKENVGLDRTPVLSDRNNLPLLEAFILEIFRHSSFLPFTIPHCTTKDTSLNGYYIPKDTCVFINQWQINHDPELWKEP 429          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71A4_SOLME (Cytochrome P450 71A4 OS=Solanum melongena GN=CYP71A4 PE=2 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.893e-18
Identity = 60/201 (29.85%), Postives = 109/201 (54.23%), Query Frame = 2
Query:  128 YNYGDFIPILRPFLRGYLKICKEVKE--RRLQLFKDYFVEER--KKLASTKSMSNESLKCAIDHILDAQTKGE----INEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAK-LGGYDVPAESKILVNAWWLANXPAPWKKP 703
            +N GD+IP L+ ++     +  +V++  ++L  F D  +EE   +      ++++E+ K  +D +L+ Q   E    +  D++  I+ +   A  +T   +++W +A+++  P   K L+NE+  +     +ITE D   + YL+AVIKE+LRL     LLVP  ++ D K LG Y +PA ++ L+N W +   P  W+ P
Sbjct:  218 FNVGDYIPWLK-WVNKITGLDTKVEKIAKKLDTFLDSVIEEHIIRNKKEEYAITDEA-KDFVDVLLEIQNGKETDFPLQRDSLKAILLDAFAAGTDTIYTNLDWTMADVLRQPRAMKTLQNEVRGLAQGKSEITEDDLKNMQYLRAVIKESLRLHPPNSLLVPRESMEDVKLLGYYHIPARTQALINVWAIGRDPLSWENP 416          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C515A_DICDI (Probable cytochrome P450 515A1 OS=Dictyostelium discoideum GN=cyp515a1 PE=3 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.893e-18
Identity = 66/224 (29.46%), Postives = 109/224 (48.66%), Query Frame = 2
Query:    5 MMYNNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDA---QTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAW 667
            ++ N +YR +F   FE  D+ L     +     ++L +       DFIPIL+PF   Y +I KE     L  F+       K ++      NE  KC +++ +      T   I   ++ YI  +I VA I TT  +++W +  L N+P IQ+KL  E++T   P H+    D  + PYL ++IKETLR+    P  +PH+   D  +    +P  ++++ N +
Sbjct:  184 ILLNILYRFLFGVSFEYDDNLLSKEFYSFIQSYNKLFEYLAKQPADFIPILKPF-NNYKEIEKEYNNC-LNFFQPLIDNILKNISDDDDDGNEP-KCFLEYFISEIRKDTSNLIKITDLPYICFDIIVAGIVTTSTTMDWMLLYLTNYPNIQEKLFFEINTPNHPLHK----DKLQFPYLNSIIKETLRISPPAPFALPHICTDDIVIDDIFIPKNTQVIPNIY 400          
The following BLAST results are available for this feature:
BLAST of FC931077 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 311
Match NameE-valueIdentityDescription
C75A2_SOLME1.449e-1827.12Flavonoid 3',5'-hydroxylase OS=Solanum melongena G... [more]
C71BK_ARATH1.449e-1838.03Cytochrome P450 71B20 OS=Arabidopsis thaliana GN=C... [more]
C71BG_ARATH1.449e-1835.37Cytochrome P450 71B16 OS=Arabidopsis thaliana GN=C... [more]
C71AI_ARATH1.449e-1833.61Cytochrome P450 71A18 OS=Arabidopsis thaliana GN=C... [more]
C71A2_SOLME1.449e-1831.53Cytochrome P450 71A2 OS=Solanum melongena GN=CYP71... [more]
CP1A2_MACFU1.893e-1828.21Cytochrome P450 1A2 OS=Macaca fuscata fuscata GN=C... [more]
CP1A1_ONCMY1.893e-1828.19Cytochrome P450 1A1 OS=Oncorhynchus mykiss GN=cyp1... [more]
CP1A1_LIZAU1.893e-1826.67Cytochrome P450 1A1 OS=Liza aurata GN=cyp1a1 PE=2 ... [more]
C71A4_SOLME1.893e-1829.85Cytochrome P450 71A4 OS=Solanum melongena GN=CYP71... [more]
C515A_DICDI1.893e-1829.46Probable cytochrome P450 515A1 OS=Dictyostelium di... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B09EF PostHarvP1 Citrus clementina cDNA clone C34101B09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931077 ID=FC931077|Name=FC931077|organism=Citrus clementina|type=EST|length=704bp
GCTTATGATGTACAACAACATGTACAGGATTATGTTTGATAGAAGATTCG
AGAGTCAGGATGATCCTTTGTTTAACAGATTAAAGGCTTTGAATGGTGAG
AGGAGTCGGTTGGCCCAGAGCTTTGAGTACAATTACGGTGATTTTATTCC
CATTTTGAGACCTTTCTTGAGAGGCTACTTGAAGATTTGTAAGGAAGTTA
AAGAAAGGAGACTCCAGCTCTTCAAGGACTACTTTGTTGAGGAGAGAAAG
AAATTGGCAAGCACGAAGAGCATGAGTAATGAAAGCTTGAAATGCGCAAT
CGATCATATTTTGGACGCTCAGACAAAGGGAGAAATCAACGAGGACAACG
TTCTATACATCGTTGAGAACATCAATGTTGCCGCGATCGAGACAACTCTT
TGGTCGATCGAGTGGGGAATTGCAGAGCTAGTGAATCATCCTGAAATCCA
GAAGAAGCTCCGCAATGAACTTGACACCGTGCTTGGTCCTGGTCATCAAA
TCACTGAGCCTGACACCCACAAACTACCCTACCTTCAGGCCGTGATCAAG
GAAACTCTTCGCCTTAGGATGGCAATTCCTCTTCTTGTGCCGCACATGAA
CCTTCACGACGCCAAGCTTGGAGGCTACGACGTCCCTGCTGAGAGCAAAA
TCCTAGTGAACGCGTGGTGGCTCGCCAACNATCCCGCCCCATGGAAGAAA
CCTG
back to top