FC931077

Overview
NameFC931077
Unique NameFC931077
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length704
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15266 contig Ccv1_Contig15266:1..704. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71A8_MENPI (Cytochrome P450 71A8 OS=Mentha piperita GN=CYP71A8 PE=3 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 5.495e-26
Identity = 68/199 (34.17%), Postives = 108/199 (54.27%), Query Frame = 2
Query:  137 GDFIPIL------RPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGE----INEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            GDF+P L        F R   +I KE+ E     F +  + ER +  + K+  N      +D +L+          I+ D++  I+ ++  A  +TT   +EW + EL+ HPEI KKL++E+  V+   H IT+ D  K+ YL+AV+KET+R    IPLLVP +  +D ++ GYDVP  + +++NAW +   P  W +P
Sbjct:  227 GDFVPSLWWINRINGFDRRVDRIAKEMDE-----FLEKVIHERLENPAAKAEEN-----FVDILLEIYRNNSAGVSIDRDSIKAIILDVFAAGTDTTAVVLEWAMTELLRHPEIMKKLQSEVRQVVKDKHNITDDDIEKMHYLKAVMKETMRFHTPIPLLVPRVARNDVEVMGYDVPVGTMVMINAWAIGRDPTSWDEP 415          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C76A2_SOLME (Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76A2 PE=2 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 4.652e-25
Identity = 63/197 (31.98%), Postives = 103/197 (52.28%), Query Frame = 2
Query:  131 NYGDFIPILRPF-LRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGE-----INEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N  D  P L+ F L+   K       + +++    F++ER++    +    E  K  +D +L+ Q  G+     ++E  +   V  + +A  ETT  S+EW + EL+ HPE   K++ E+   + P  +  + D   LPY+QAV+KE+LRL   +P L+P   + D K  GYDVP ++++LVNAW +   P  W  P
Sbjct:  224 NVSDIFPFLKKFDLQSLRKKMARDMGKAVEIMS-MFLKEREE---ERKKGTEKGKDFLDVLLEFQGTGKDEPAKLSEHEIKIFVLEMFLAGTETTSSSVEWALTELLRHPEAMAKVKTEISQAIEPNRKFEDSDIENLPYMQAVLKESLRLHPPLPFLIPRETIQDTKFMGYDVPKDTQVLVNAWAIGRDPECWDDP 416          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C93A3_SOYBN (Cytochrome P450 93A3 OS=Glycine max GN=CYP93A3 PE=2 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 1.353e-24
Identity = 66/237 (27.85%), Postives = 129/237 (54.43%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPF-LRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMS------NESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N + R++  +   ++D+     ++ L  + + L+  F  N  DF+  L+ F L+G+ K  +++++       D  +++R++    K+ +       + L    D   D  ++ ++N++N+   + +I +A  +T+  ++EW +AEL+N+P + +K R E+D V+G    + E D   LPYLQ +++ETLRL  A PLL    +   A + GYD+PA++++ VN W +   P  W+ P
Sbjct:  181 NIVSRMIVSQTSTTEDENEVEEMRKLVKDAAELSGKF--NISDFVSFLKRFDLQGFNKRLEKIRDC-FDTVLDRIIKQREEERRNKNETVGKREFKDMLDVLFDISEDESSEIKLNKENIKAFILDILIAGTDTSAVTMEWAMAELINNPGVLEKARQEMDAVVGKSRIVEESDIANLPYLQGIVRETLRLHPAGPLLFRESS-RRAVVCGYDIPAKTRLFVNVWAIGRDPNHWENP 413          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C93A2_SOYBN (Cytochrome P450 93A2 OS=Glycine max GN=CYP93A2 PE=2 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 1.768e-24
Identity = 70/242 (28.93%), Postives = 130/242 (53.72%), Query Frame = 2
Query:    2 LMMYNNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPF-LRGYLKICKEVKERRLQLFKDYFVEER-------KKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            + + NN+   M   +  S+D+     ++ L  + + L  +F  N  DFI  L+PF L+G+ K  ++ + R      D  +++R       K++  T+    + L   +D   D  ++ ++ ++N+   + +I VA  +T+  ++EW +AEL+N+P + +K R E+D V+G    I E D   LPYLQA+++ETLR+    PL+V   +     + GY++PA++++ VN W +   P  W+ P
Sbjct:  169 MRLSNNIISRMTMNQTSSEDEKQAEEMRMLVADVAELMGTF--NVSDFIWFLKPFDLQGFNKRIRKTRIR-FDAVLDRIIKQREEERRNNKEIGGTRQFK-DILDVLLDIGEDDSSEIKLTKENIKAFIMDIFVAGTDTSAATMEWAMAELINNPCVLEKARQEIDAVVGNSRIIEESDIVNLPYLQAIVRETLRIHPGGPLIVRESS-KSVVVCGYEIPAKTRLFVNVWAIGRDPNHWENP 405          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C81E1_GLYEC (Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata GN=CYP81E1 PE=1 SV=2)

HSP 1 Score: 112.849 bits (281), Expect = 1.768e-24
Identity = 76/237 (32.07%), Postives = 124/237 (52.32%), Query Frame = 2
Query:    5 MMYNNMYRIMFDRRFESQDDPLFNRLKA--LNGERSRLAQ-SFEYNYGDFIPILRPFL--RGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQ-TKGEINEDNVLY-IVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPW 694
            M +NN+ R++  +R+  +D    +  +A       S L Q S   N  DF+P+LR FL      K  K++  +     +    E R K     +M        IDH+L+ Q ++ E   D ++  +   + +A  +++  ++EW ++ L+NHPE+ KK+++ELDT +G    + E D  KL YL+ VI ETLRL    PLL+PH    +  +GGY VP ++ +L+NAW +   P  W
Sbjct:  179 MTFNNIMRMISGKRYYGEDCDTSDLQEASQFRDMVSELLQLSGANNKTDFMPLLR-FLDFENLEKRLKDISGKTDAFLRGLIEEHRTKKERANTM--------IDHLLNLQDSQPEYYTDQIIKGLALAMLLAGTDSSAVTLEWSMSNLLNHPEVLKKVKDELDTHVGQDRLVDESDLPKLTYLKNVINETLRLYTPAPLLLPHSTSDECNIGGYKVPQDTIVLINAWAIHRDPELW 406          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71C1_MAIZE (Cytochrome P450 71C1 OS=Zea mays GN=CYP71C1 PE=2 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 3.938e-24
Identity = 63/194 (32.47%), Postives = 101/194 (52.06%), Query Frame = 2
Query:  128 YNYGDFIPILRP---FLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKK 700
            +N  D+ P L     FLR      K V +R   LF +   E           ++E     +  +L  Q    +  DN+  I+ N+  AAIET+   +E+ ++EL+N+  +  KL+ E+ T    G  + E D  ++PYL+A IKE++R+    P L+PH + HD ++ GY +PA ++++VNAW LA  P  W K
Sbjct:  243 FNVEDYFPKLADVDLFLRIICAKAKSVSKRWDSLFNELLSEYALSGGKQGDHNSEDF---VHLLLSLQKDYGLTTDNIKGILVNMFEAAIETSFLVLEYSMSELMNNRHVLAKLQKEVRTATPDGRMVMEEDLSRMPYLKATIKESMRIHPPAPFLLPHFSTHDCEINGYTIPAGTRVIVNAWALARDPTCWDK 433          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C78A4_PINRA (Cytochrome P450 78A4 OS=Pinus radiata GN=CYP78A4 PE=2 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 6.717e-24
Identity = 73/235 (31.06%), Postives = 126/235 (53.62%), Query Frame = 2
Query:   14 NNMYRIMFDRRFE-SQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPF--LRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLV-PHMNLHDAKLG-GYDVPAESKILVNAWWLANXPAPWKKP 703
            NN+   +F RRF+ S ++    +L+ +  E  +L  +F  N+ D +P LRP   LR + +  + V   R+  F    +E+ ++    +   ++     +D +L  Q + +++E++++ ++  +     +TT    EW +AELV HPE QKK + ELD V+G    + + D  KLPY+QAV+KE LR+    PLL    ++  D  +G G  VPA +  +VN W + + P  W+ P
Sbjct:  227 NNIMGSVFGRRFDMSHENEEVKKLREMVDEGFQLLGAF--NWADHLPWLRPLDPLRIHARCARLVP--RVTTFVSNIIEQHRREEQRRESGDQC--DFVDVLLSLQGEDKLDEEDMIAVLWEMIFRGTDTTALLTEWTMAELVLHPEAQKKAQAELDAVVGHDRSVKDSDIPKLPYIQAVVKEALRMHPPGPLLSWARLSTEDVNMGDGMCVPAGTTAMVNMWSITHDPNIWESP 455          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C76C1_ARATH (Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 1.496e-23
Identity = 58/190 (30.53%), Postives = 110/190 (57.89%), Query Frame = 2
Query:  140 DFIPILRPF-LRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQ-TKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            ++ P LR   L+G +K  K   ER +++F+ +   +  + +S  +  + S    +D++LD +  + E++  ++ +++ ++  A  +T+  ++EW + EL+ +P+   K + E+D V+G    + E D  KLPYLQAV+KET RL   +PLL+P     DA++ G+ V  ++++LVN W +   P+ W  P
Sbjct:  229 NYFPFLRFLDLQGNVKTFKVCTERLVRVFRGFIDAKIAEKSSQNNPKDVSKNDFVDNLLDYKGDESELSISDIEHLLLDMFTAGTDTSSSTLEWAMTELLKNPKTMAKAQAEIDCVIGQNGIVEESDISKLPYLQAVVKETFRLHTPVPLLIPRKAESDAEILGFMVLKDTQVLVNVWAIGRDPSVWDNP 418          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71A1_PERAE (Cytochrome P450 71A1 OS=Persea americana GN=CYP71A1 PE=1 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 1.496e-23
Identity = 65/238 (27.31%), Postives = 117/238 (49.16%), Query Frame = 2
Query:    2 LMMYNNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILR--PFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEI----NEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWK 697
            L+    + R+ F +++E +++   N+   L  E + L  +F    GD+ P       L G     K      L  F D+ +++               K  +D +L  Q    +    N +N+  ++ ++     +TT  ++EW +AEL+ HP++ +K + E+  V+G   ++ E D H+L YL+ +IKETLRL    PLLVP  +  D  + GY +PA++++ +NAW +   P  W+
Sbjct:  176 LLSSGTITRVAFGKKYEGEEERK-NKFADLATELTTLMGAFFV--GDYFPSFAWVDVLTGMDARLKR-NHGELDAFVDHVIDDHLLSRKANGSDGVEQKDLVDVLLHLQKDSSLGVHLNRNNLKAVILDMFSGGTDTTAVTLEWAMAELIKHPDVMEKAQQEVRRVVGKKAKVEEEDLHQLHYLKLIIKETLRLHPVAPLLVPRESTRDVVIRGYHIPAKTRVFINAWAIGRDPKSWE 409          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C76C4_ARATH (Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=2 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 2.552e-23
Identity = 62/194 (31.96%), Postives = 110/194 (56.70%), Query Frame = 2
Query:  131 NYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYF---VEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            NY  F+  L   L+G  K  + + ER  ++F+ +    + E+     +K +SN     ++  IL+   + E++ +++ +++ ++  A  +T+  ++EW +AEL+ +P+   K + E+D VLG    + E D   LPYLQAV+KET RL  A PLLVP     D ++ G+ VP ++++LVN W +   P+ W+ P
Sbjct:  228 NYFPFMGFLD--LQGNRKAMRGLTERLFRVFRGFMDAKIAEKSLGNYSKDVSNRDFLDSL-LILNEGDEAELDNNDIEHLLLDMFTAGTDTSSSTLEWAMAELLRNPKTMVKAQAEMDRVLGQNSVVQESDISGLPYLQAVVKETFRLHPAAPLLVPRKAESDVEVLGFMVPKDTQVLVNVWAIGRDPSVWENP 418          
The following BLAST results are available for this feature:
BLAST of FC931077 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 311
Match NameE-valueIdentityDescription
C71A8_MENPI5.495e-2634.17Cytochrome P450 71A8 OS=Mentha piperita GN=CYP71A8... [more]
C76A2_SOLME4.652e-2531.98Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76... [more]
C93A3_SOYBN1.353e-2427.85Cytochrome P450 93A3 OS=Glycine max GN=CYP93A3 PE=... [more]
C93A2_SOYBN1.768e-2428.93Cytochrome P450 93A2 OS=Glycine max GN=CYP93A2 PE=... [more]
C81E1_GLYEC1.768e-2432.07Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata ... [more]
C71C1_MAIZE3.938e-2432.47Cytochrome P450 71C1 OS=Zea mays GN=CYP71C1 PE=2 S... [more]
C78A4_PINRA6.717e-2431.06Cytochrome P450 78A4 OS=Pinus radiata GN=CYP78A4 P... [more]
C76C1_ARATH1.496e-2330.53Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CY... [more]
C71A1_PERAE1.496e-2327.31Cytochrome P450 71A1 OS=Persea americana GN=CYP71A... [more]
C76C4_ARATH2.552e-2331.96Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CY... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B09EF PostHarvP1 Citrus clementina cDNA clone C34101B09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931077 ID=FC931077|Name=FC931077|organism=Citrus clementina|type=EST|length=704bp
GCTTATGATGTACAACAACATGTACAGGATTATGTTTGATAGAAGATTCG
AGAGTCAGGATGATCCTTTGTTTAACAGATTAAAGGCTTTGAATGGTGAG
AGGAGTCGGTTGGCCCAGAGCTTTGAGTACAATTACGGTGATTTTATTCC
CATTTTGAGACCTTTCTTGAGAGGCTACTTGAAGATTTGTAAGGAAGTTA
AAGAAAGGAGACTCCAGCTCTTCAAGGACTACTTTGTTGAGGAGAGAAAG
AAATTGGCAAGCACGAAGAGCATGAGTAATGAAAGCTTGAAATGCGCAAT
CGATCATATTTTGGACGCTCAGACAAAGGGAGAAATCAACGAGGACAACG
TTCTATACATCGTTGAGAACATCAATGTTGCCGCGATCGAGACAACTCTT
TGGTCGATCGAGTGGGGAATTGCAGAGCTAGTGAATCATCCTGAAATCCA
GAAGAAGCTCCGCAATGAACTTGACACCGTGCTTGGTCCTGGTCATCAAA
TCACTGAGCCTGACACCCACAAACTACCCTACCTTCAGGCCGTGATCAAG
GAAACTCTTCGCCTTAGGATGGCAATTCCTCTTCTTGTGCCGCACATGAA
CCTTCACGACGCCAAGCTTGGAGGCTACGACGTCCCTGCTGAGAGCAAAA
TCCTAGTGAACGCGTGGTGGCTCGCCAACNATCCCGCCCCATGGAAGAAA
CCTG
back to top