FC931077

Overview
NameFC931077
Unique NameFC931077
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length704
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15266 contig Ccv1_Contig15266:1..704. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2J3_RAT (Cytochrome P450 2J3 OS=Rattus norvegicus GN=Cyp2j3 PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 4.364e-15
Identity = 63/236 (26.69%), Postives = 101/236 (42.80%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTK------GEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N +  + F  RFE  D      L+ L+ E   L  S      +  P +  +L G  +       R+L+LF    ++  ++         +  +  ID  L    K         NE+N++    ++  A  ETT  ++ W +  +  +PE+Q+K++ E+D V+G G Q    D   +PY  AVI E  R+   IP  VP     D  L G+++P  + IL N   L   P  W  P
Sbjct:  190 NIICSVTFGERFEYHDSQFQEMLRLLD-EAMCLESSMMCQLYNIFPRILQYLPGSHQTLFS-NWRKLKLFISDIIKNHRR-----DWDPDEPRDFIDAFLKEMAKYPDKTTTSFNEENLICSTLDLFFAGTETTSTTLRWALLCMALYPEVQEKMQAEIDRVIGQGRQPNLADRDSMPYTNAVIHEVQRIGNIIPFNVPREVAVDTYLAGFNLPKGTMILTNLTALHRDPKEWATP 418          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP17A_PAPHU (Steroid 17-alpha-hydroxylase/17,20 lyase OS=Papio hamadryas ursinus GN=CYP17A1 PE=1 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 4.364e-15
Identity = 54/204 (26.47%), Postives = 96/204 (47.06%), Query Frame = 2
Query:  140 DFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDN----------------VLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            D  P L+ F    L+  K   + R  L    F   ++K  S           +I ++LD   + ++N DN                +L  + +I  A +ETT   ++W +A L+++P+++KKL   +D  +G     T  D ++L  L+A I+E LR+R   P+L+PH    D+ +G + V   + +++N W L +    W +P
Sbjct:  216 DLFPWLKVFPNKTLEKLKRHVKTRNDLLTKIFENYKEKFRSD----------SITNMLDVLMQAKMNSDNGNAGPDQDSELLSDNHILTTIGDIFGAGVETTTSVVKWIVAFLLHNPQVKKKLYEGIDQNVGFSRTPTISDRNRLLLLEATIREVLRIRPVAPMLIPHKANVDSSIGEFAVDKGTHVIINLWALHHNEKEWHQP 409          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C508B_DICDI (Probable cytochrome P450 508B1 OS=Dictyostelium discoideum GN=cyp508b1 PE=3 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 4.364e-15
Identity = 57/217 (26.27%), Postives = 104/217 (47.93%), Query Frame = 2
Query:   20 MYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSF-EYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGG--YDVPAESKILVN 661
            M++ +F+      +D    ++  L     ++ +S      GDFI I +PF   +LK   +         K +    ++ L    ++ +++ +  +D +++  +  +     +L    ++ +A  +TT  SI W +  +  HPEIQ K  NE+   +G   ++   D  K PYL A+IKE LRL    P  +PH + +D  +G   Y +P +S+ILVN
Sbjct:  177 MFKYIFNEDISYDEDITKGKIAELVQPMDQIFKSLGSGKLGDFISIAQPFYYQWLKFSDKQFNGPFSTVKKFIY--KRYLEHINTIDHDNPRDLMDLLINEFSNDKNLIPTILQTSLDMFLAGNDTTAASIIWFVLRMQEHPEIQLKAYNEIKDAVGDRDRVLLSDRPKTPYLNAIIKEILRLNPVGPFGLPHRSSNDIVIGNGKYFIPKDSQILVN 391          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: KO1_ARATH (Ent-kaurene oxidase OS=Arabidopsis thaliana GN=KO1 PE=1 SV=2)

HSP 1 Score: 81.2629 bits (199), Expect = 5.699e-15
Identity = 52/196 (26.53%), Postives = 95/196 (48.47%), Query Frame = 2
Query:  119 SFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHIL-DAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            + + ++ DF P L+       +   + K +R     +  +++R K   ++S  +    C ++ ++ +A+T   + ++ +  +V    +   +TTL + EW I EL  HP +Q +L  E+  V G G +  E    ++PYL  V  ETLR     PL+       D ++GGY VPA S+I +N +        W++P
Sbjct:  235 AIDVDWRDFFPYLKWIPNKSFEARIQQKHKRRLAVMNALIQDRLKQNGSESDDD----CYLNFLMSEAKT---LTKEQIAILVWETIIETADTTLVTTEWAIYELAKHPSVQDRLCKEIQNVCG-GEKFKEEQLSQVPYLNGVFHETLRKYSPAPLVPIRYAHEDTQIGGYHVPAGSEIAINIYGCNMDKKRWERP 422          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2J6_MOUSE (Cytochrome P450 2J6 OS=Mus musculus GN=Cyp2j6 PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 5.699e-15
Identity = 59/235 (25.11%), Postives = 101/235 (42.98%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTK-----GEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N +  + F  RF+  D      L+ L+             Y  F  I++     + K+ +  +  +L+LF    +++ +K       + +  +  ID  L   TK        NE+N++    ++  A  ETT  ++ W +  +  +PE+Q+K++ E+D V+G        D   +PY  AVI E  R+   IPL VP     D  L G+ +P  + +L N   L   P  W  P
Sbjct:  190 NIICSVTFGERFDYHDSRFQEMLRLLDEVMYLETTMISQLYNIFPWIMKYIPGSHQKVFRNWE--KLKLFVSCMIDDHRK-----DWNPDEPRDFIDAFLKEMTKYPEKTTSFNEENLICSTLDLFFAGTETTSTTLRWALLYMALYPEVQEKVQAEIDRVIGQKRAARLADRESMPYTNAVIHEVRRMGNIIPLNVPREVAMDTNLNGFHLPKGTMVLTNLTALHRDPKEWATP 417          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71D9_SOYBN (Cytochrome P450 71D9 OS=Glycine max GN=CYP71D9 PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 5.699e-15
Identity = 48/193 (24.87%), Postives = 98/193 (50.78%), Query Frame = 2
Query:  128 YNYGDFIPILR--PFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGE--INEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPW 694
            ++ GD  P ++    + G     +++ ++  Q+ ++   E R+  +S      E      + +LD   K E  ++++++  ++ +I     +T+  +I W +AE++ +P   +K++ E+  V     +     T  L YL++V+ ETLRL    PLL+P       ++ GY +PA+S+++VNAW +   P  W
Sbjct:  215 FDLGDLYPSVKFLQHMSGLKPKLEKLHQQADQIMQNIINEHREAKSSATGDQGEE-----EVLLDVLLKKEFGLSDESIKAVIWDIFGGGSDTSSATITWAMAEMIKNPRTMEKVQTEVRRVFDKEGRPNGSGTENLKYLKSVVSETLRLHPPAPLLLPRECGQACEINGYHIPAKSRVIVNAWAIGRDPRLW 402          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2J5_MOUSE (Cytochrome P450 2J5 OS=Mus musculus GN=Cyp2j5 PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 7.444e-15
Identity = 59/231 (25.54%), Postives = 104/231 (45.02%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRG-YLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N +  + F  RF+ +D      L+ L+     +  S    Y  F P +  +L G + KI +     +L+LF  + V++ +K  +     +      I+   D       NE+N++    ++ +   ETT  ++ W +  + ++PEIQ+ ++ E+D V+G   Q++  D   +PY  AVI E  R+   +PL        D K  G+ +P  + IL N   L   P  W  P
Sbjct:  190 NIICSVTFGERFDYEDCQFQELLQLLDETMHLMGSSAGQLYNGF-PCIMKYLPGPHQKIFRNWG--KLKLFVSHIVKKHEKDWNPDEPRDFIDAFLIEMQKDPDRTTSFNEENLISTTLDLFLGGTETTSSTLRWALLYMSSYPEIQENVQAEIDRVIGHKRQVSLSDRESMPYTNAVIHEVQRMGNIVPLNSSREVTVDTKFNGFHLPKGTMILTNLTALHRDPKEWATP 417          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2DQ_RAT (Cytochrome P450 2D26 OS=Rattus norvegicus GN=Cyp2d26 PE=2 SV=2)

HSP 1 Score: 80.8777 bits (198), Expect = 7.444e-15
Identity = 59/234 (25.21%), Postives = 107/234 (45.73%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILR--PFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGE--INEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N +  +++ RRFE  +DP FNR+     E       F     + IPIL   P L G  K+  ++         D  + E KK         +     +  +  A+   E   N++N+  +V ++ +A + TT  ++ W +  ++ HP++Q+++  E+D V+G   +    D  ++P+  AVI E  R    +P  +PHM   D K  G+ +P  + ++ N   +      W+KP
Sbjct:  187 NVIASLVYARRFE-YEDPFFNRMLKTLKESFGEDTGFMAEVLNAIPILLQIPGLPG--KVFPKLNS--FIALVDKMLIEHKKSWDPAQPPRDMTDAFLAEMQKAKGNPESSFNDENLRLVVIDLFMAGMVTTSTTLSWALLLMILHPDVQRRVHEEIDEVIGQVRRPEMADQARMPFTNAVIHEVQRFADIVPTNIPHMTSRDIKFQGFLIPKGTTLIPNLSSVLKDETVWEKP 415          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2K1_ONCMY (Cytochrome P450 2K1 OS=Oncorhynchus mykiss GN=cyp2k1 PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 9.722e-15
Identity = 60/238 (25.21%), Postives = 108/238 (45.38%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHIL-DAQTKGE-------INEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N +  I++  RFE   DPLF  +     E   L  S      +  P L P++    ++ K + + ++++     +E  + L  T  ++    +  +D  L   QT  E        ++DN+++ V N+  A  +TT  ++ WG+  +  +P IQ +++ E+  V+G    + E D   LPY  AVI ET RL   +P+ VPH    D    GY +   + ++     +    + W+ P
Sbjct:  188 NIISAIVYGSRFE-YTDPLFTGMADRAKESIHLTGSASIQMYNMFPWLGPWINNLTRLKKNIADMKMEV-----IELVRGLKET--LNPHMCRGFVDSFLVRKQTLEESGHMDSFYHDDNLVFSVGNLFSAGTDTTGTTLRWGLLLMTKYPHIQDQVQEEISRVIGSRQTLVE-DRKNLPYTDAVIHETQRLANIVPMSVPHTTSRDVTFQGYFIKKGTSVIPLLTSVLQDDSEWESP 416          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2E1_MESAU (Cytochrome P450 2E1 OS=Mesocricetus auratus GN=CYP2E1 PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 9.722e-15
Identity = 59/222 (26.58%), Postives = 101/222 (45.50%), Query Frame = 2
Query:   11 YNNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINV-------AAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKIL 655
            +N +  I+F +RF+  D      +   N     L+  +   Y +F   LR     + KI K   E R      Y + + K+    +S+ +   +   D +L    K E +    +Y +ENI+V       A  ETT  ++ +G+  L+ +PE+++KL  E+D V+GP       D  ++PY+ AV+ E  R    IP  +PH    D    GY +P  + ++
Sbjct:  177 FNVISDILFHKRFDYNDKTCLRLMSLFNENFYLLSTPWIQAYNNFENYLRYLPGSHRKIMKNASEIR-----QYTLAKAKE--HLQSLDSSCPRDVTDCLLIEMEK-EKDSQEPMYTMENISVTLADLFFAGTETTSTTLRYGLLILMKYPEVEEKLHEEIDRVIGPSRVPVFKDRLEMPYMDAVVHEIQRFISLIPSNLPHEATRDTMFRGYVIPKGTVVI 390          
The following BLAST results are available for this feature:
BLAST of FC931077 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 311
Match NameE-valueIdentityDescription
CP2J3_RAT4.364e-1526.69Cytochrome P450 2J3 OS=Rattus norvegicus GN=Cyp2j3... [more]
CP17A_PAPHU4.364e-1526.47Steroid 17-alpha-hydroxylase/17,20 lyase OS=Papio ... [more]
C508B_DICDI4.364e-1526.27Probable cytochrome P450 508B1 OS=Dictyostelium di... [more]
KO1_ARATH5.699e-1526.53Ent-kaurene oxidase OS=Arabidopsis thaliana GN=KO1... [more]
CP2J6_MOUSE5.699e-1525.11Cytochrome P450 2J6 OS=Mus musculus GN=Cyp2j6 PE=2... [more]
C71D9_SOYBN5.699e-1524.87Cytochrome P450 71D9 OS=Glycine max GN=CYP71D9 PE=... [more]
CP2J5_MOUSE7.444e-1525.54Cytochrome P450 2J5 OS=Mus musculus GN=Cyp2j5 PE=2... [more]
CP2DQ_RAT7.444e-1525.21Cytochrome P450 2D26 OS=Rattus norvegicus GN=Cyp2d... [more]
CP2K1_ONCMY9.722e-1525.21Cytochrome P450 2K1 OS=Oncorhynchus mykiss GN=cyp2... [more]
CP2E1_MESAU9.722e-1526.58Cytochrome P450 2E1 OS=Mesocricetus auratus GN=CYP... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B09EF PostHarvP1 Citrus clementina cDNA clone C34101B09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931077 ID=FC931077; Name=FC931077; organism=Citrus clementina; type=EST; length=704bp
GCTTATGATGTACAACAACATGTACAGGATTATGTTTGATAGAAGATTCG
AGAGTCAGGATGATCCTTTGTTTAACAGATTAAAGGCTTTGAATGGTGAG
AGGAGTCGGTTGGCCCAGAGCTTTGAGTACAATTACGGTGATTTTATTCC
CATTTTGAGACCTTTCTTGAGAGGCTACTTGAAGATTTGTAAGGAAGTTA
AAGAAAGGAGACTCCAGCTCTTCAAGGACTACTTTGTTGAGGAGAGAAAG
AAATTGGCAAGCACGAAGAGCATGAGTAATGAAAGCTTGAAATGCGCAAT
CGATCATATTTTGGACGCTCAGACAAAGGGAGAAATCAACGAGGACAACG
TTCTATACATCGTTGAGAACATCAATGTTGCCGCGATCGAGACAACTCTT
TGGTCGATCGAGTGGGGAATTGCAGAGCTAGTGAATCATCCTGAAATCCA
GAAGAAGCTCCGCAATGAACTTGACACCGTGCTTGGTCCTGGTCATCAAA
TCACTGAGCCTGACACCCACAAACTACCCTACCTTCAGGCCGTGATCAAG
GAAACTCTTCGCCTTAGGATGGCAATTCCTCTTCTTGTGCCGCACATGAA
CCTTCACGACGCCAAGCTTGGAGGCTACGACGTCCCTGCTGAGAGCAAAA
TCCTAGTGAACGCGTGGTGGCTCGCCAACNATCCCGCCCCATGGAAGAAA
CCTG
back to top