FC931077

Overview
NameFC931077
Unique NameFC931077
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length704
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15266 contig Ccv1_Contig15266:1..704. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2DK_MESAU (Cytochrome P450 2D20 OS=Mesocricetus auratus GN=CYP2D20 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.404e-13
Identity = 34/126 (26.98%), Postives = 68/126 (53.97%), Query Frame = 2
Query:  326 KGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            +   N++N+  +V ++ +A + TT  ++ W +  ++ HP++Q +++ E+D V+G   +    D  ++PY  AVI E  R     P+ VPHM   D ++ G+ +P  + ++ N   +      W+KP
Sbjct:  290 ESSFNDENLHVVVADLFIAGMVTTSTTLSWALLLMILHPDVQSRVQQEIDDVIGQVRRPEMADQARMPYTNAVIHEVQRFGDIAPVNVPHMTSRDVEVQGFLIPKGTTLIPNLSSVLKDETVWEKP 415          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2DG_CAVPO (Cytochrome P450 2D16 OS=Cavia porcellus GN=CYP2D16 PE=1 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.404e-13
Identity = 55/232 (23.71%), Postives = 102/232 (43.97%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGE--INEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N +  +++ RRF+  DDP+  RL     E  R   S +    + IP+L        K+     +R      D  + E     +      +     +  +  AQ   E   N++N+  +V ++  A + TT  ++ W +  ++ HP++Q+ ++ E+D V+G        D   +P+  AVI E  R    +P+ VPHM   D ++ G+ +P  + +  N   +      W+KP
Sbjct:  187 NVISSLIYARRFD-YDDPMVLRLLEFLEETLRENSSLKIQVLNSIPLLLRIPCVAAKVLSA--QRSFIALNDKLLAEHNTGWAPDQPPRDLTDAFLTEMHKAQGNSESSFNDENLRLLVSDLFGAGMVTTSVTLSWALLLMILHPDVQRHVQEEIDEVIGQVRCPEMADQAHMPFTNAVIHEVQRFADIVPMGVPHMTSRDTEVQGFLIPKGTMLFTNLSSVLKDETVWEKP 415          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71DI_MENSP (Cytochrome P450 71D18 OS=Mentha spicata GN=CYP71D18 PE=1 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.404e-13
Identity = 44/166 (26.51%), Postives = 82/166 (49.40%), Query Frame = 2
Query:  206 RRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            RRL    D F+EE ++  S +    + +         +  K  I  + +   + +   A  ET+  +I W ++EL+ +P    K++ E+   L     +   +  +L YL++V+KETLRL    P L+P  +  + ++ GY +PA+++I +N W +   P  W+ P
Sbjct:  240 RRLDHILDGFLEEHREKKSGEFGGEDIVDVLFRMQKGSDIKIPITSNCIKGFIFDTFSAGAETSSTTISWALSELMRNPAKMAKVQAEVREALKGKTVVDLSEVQELKYLRSVLKETLRLHPPFP-LIPRQSREECEVNGYTIPAKTRIFINVWAIGRDPQYWEDP 404          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: C71DI_MENGR (Cytochrome P450 71D18 OS=Mentha gracilis GN=CYP71D18 PE=1 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.404e-13
Identity = 44/166 (26.51%), Postives = 82/166 (49.40%), Query Frame = 2
Query:  206 RRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            RRL    D F+EE ++  S +    + +         +  K  I  + +   + +   A  ET+  +I W ++EL+ +P    K++ E+   L     +   +  +L YL++V+KETLRL    P L+P  +  + ++ GY +PA+++I +N W +   P  W+ P
Sbjct:  240 RRLDHILDGFLEEHREKKSGEFGGEDIVDVLFRMQKGSDIKIPITSNCIKGFIFDTFSAGAETSSTTISWALSELMRNPAKMAKVQAEVREALKGKTVVDLSEVQELKYLRSVLKETLRLHPPFP-LIPRQSREECEVNGYTIPAKTRIFINVWAIGRDPQYWEDP 404          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2DJ_CALJA (Cytochrome P450 2D19 OS=Callithrix jacchus GN=CYP2D19 PE=2 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.833e-13
Identity = 61/227 (26.87%), Postives = 105/227 (46.26%), Query Frame = 2
Query:   41 RRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILR--PFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGE----INEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            RRFE  +DP   RL  L  E  +          + IP+L   P L G  K+ +  K    QL  D  + E +          +  +  +  +   +TKG      N++N+  +V ++  A + TT  ++ WG+  ++ HP++Q++++ E+D V+G   +    D   +PY  AVI E  R    +PL V HM   D ++ G+ +P  + +  N   +    A W+KP
Sbjct:  193 RRFE-YNDPCLLRLLDLTMEGLKEESGLLREVLNAIPVLLRIPGLAG--KVLRSQKAFLAQL--DELLTEHRMTWDPAQPPRDLTEAFLAEM--EKTKGNPESSFNDENLHLVVADLFSAGMVTTSITLAWGLLLMILHPDVQRRVQQEIDDVIGRVRRPEMGDQTYMPYTTAVIHEVQRFADIVPLGVTHMTSRDIEVQGFLIPKGTTLFTNLSSVLKDEANWEKP 412          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2DE_BOVIN (Cytochrome P450 2D14 OS=Bos taurus GN=CYP2D14 PE=2 SV=2)

HSP 1 Score: 76.2554 bits (186), Expect = 1.833e-13
Identity = 38/161 (23.60%), Postives = 79/161 (49.07%), Query Frame = 2
Query:  227 DYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGE--INEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            D  + E+K                +D + +A+   E   N++N+  +V ++  A + TT  ++ W +  ++ HP++Q++++ E+D V+G   +    D   +P+  AV+ E  R    +PL +PHM   D ++ G+ +P  + ++ N   +      W+KP
Sbjct:  255 DELIAEQKMTRDPTQPPRHLTDAFLDEVKEAKGNPESSFNDENLRLVVADLFSAGMVTTSTTLAWALLLMILHPDVQRRVQQEIDEVIGQVRRPEMGDQALMPFTVAVVHEVQRFADIVPLGLPHMTSRDIEVQGFHIPKGTTLITNLSSVLKDETVWEKP 415          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2C8_HUMAN (Cytochrome P450 2C8 OS=Homo sapiens GN=CYP2C8 PE=1 SV=2)

HSP 1 Score: 76.2554 bits (186), Expect = 1.833e-13
Identity = 58/219 (26.48%), Postives = 103/219 (47.03%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRG-YLKICKEVKERRLQLFKDYFVEERKKLASTKSMSN--ESLKCAIDHILDAQT--KGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKIL 655
            N +  ++F +RF+ +D      +K  N E  R+  S      +  P+L     G + K+ K V      L + Y  E+ K+  ++  ++N  + + C +  +   +   K E N +N++  V ++ VA  ETT  ++ +G+  L+ HPE+  K++ E+D V+G        D   +PY  AV+ E  R    +P  VPH    D K   Y +P  + I+
Sbjct:  176 NVICSVVFQKRFDYKDQNFLTLMKRFN-ENFRILNSPWIQVCNNFPLLIDCFPGTHNKVLKNVA-----LTRSYIREKVKEHQASLDVNNPRDFIDCFLIKMEQEKDNQKSEFNIENLVGTVADLFVAGTETTSTTLRYGLLLLLKHPEVTAKVQEEIDHVIGRHRSPCMQDRSHMPYTDAVVHEIQRYSDLVPTGVPHAVTTDTKFRNYLIPKGTTIM 388          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2E1_MACFA (Cytochrome P450 2E1 (Fragment) OS=Macaca fascicularis GN=CYP2E1 PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 2.395e-13
Identity = 57/216 (26.39%), Postives = 98/216 (45.37%), Query Frame = 2
Query:   29 IMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINV-------AAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKIL 655
            I+F +RF+  D+     +   N     L+  +   Y +F  +L      + K+ K V E      K+Y  E  K+    +S+     +   D +L    K + + +  LY ++ I V       A  ETT  ++ +G+  L+ +PEI++KL  E+D V+GP       D  ++PY+ AV+ E  R    +P  +PH    D    GY +P  + I+
Sbjct:  139 ILFRKRFDYNDEKFLRLMYLFNENFQGLSCPWLQLYNNFPSLLHYLPGSHRKVMKNVAE-----IKEYVSERVKE--HHQSLDPNCPRDLTDCLLVEMEKEKHSAER-LYTMDGITVTVADLFFAGTETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIPAIKDRQEMPYMHAVVHEIQRFITLVPSNLPHEATRDTIFRGYIIPKGTVIV 346          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP2DS_MESAU (Cytochrome P450 2D28 OS=Mesocricetus auratus GN=CYP2D28A PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 2.395e-13
Identity = 50/232 (21.55%), Postives = 104/232 (44.83%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGE--INEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANXPAPWKKP 703
            N +  ++F RRFE +D  L   L+ L    + ++         F P+L      + K+     ++      D  + E ++    +          +  +  A+   E   N+ N+  +V ++ +A   +T  ++ W +  ++ +P++Q++++ E+D +LGPG      D  ++PY  AVI E  R     PL +P +   D ++ G+ +P  + ++ N   +      W+KP
Sbjct:  187 NVITSLIFARRFEYEDANLIRMLRLLEEALTNISGFIPEILNTF-PVLLHIPGLFDKVFSG--QKTFAAIVDNLLTENRRTWDPEQPPRGLTDAFLAEMEKAKGNPESSFNDQNLRMVVNDLFIAGTVSTSTTLSWALLFMIQYPDVQRRVQQEIDDILGPGRSPEMADQARMPYTNAVIHEVQRFADIAPLNLPCITSRDIEVQGFLIPKGTTLITNLSSVLKDETVWEKP 415          
BLAST of FC931077 vs. ExPASy Swiss-Prot
Match: CP241_CANFA (Cytochrome P450 2C41 OS=Canis familiaris GN=CYP2C41 PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 2.395e-13
Identity = 58/222 (26.13%), Postives = 99/222 (44.59%), Query Frame = 2
Query:   14 NNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERKKLASTKSMSNESLKCAIDHILDAQTKGEINE------DNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVN 661
            N +  I+F  RF+  D  L   L+ LN     L+  +   Y  F     P L  YL        +     K Y +E+ K+   +  ++N   +  ID+ L    + + N+      +N+  I  ++  A  ETT  ++ +G+  L+ HPE+  K++ E+D V+G        D  ++PY  AV+ E  R    +P  +PH    D K   Y +P  + IL++
Sbjct:  175 NVICSIIFQNRFDYTDQTLIGFLEKLNENFRILSSPWIQAYNSF-----PALLHYLPGSHNTIFKNFAFIKSYILEKIKEHQESFDVNNP--RDFIDYFLIKMEQEKHNQPLEFTFENLKTIATDLFGAGTETTSTTLRYGLLLLLKHPEVTVKVQEEIDRVIGRHQSPHMQDRSRMPYTNAVLHEIQRYIDLVPNSLPHAVTCDVKFRNYVIPKGTTILIS 389          
The following BLAST results are available for this feature:
BLAST of FC931077 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 311
Match NameE-valueIdentityDescription
CP2DK_MESAU1.404e-1326.98Cytochrome P450 2D20 OS=Mesocricetus auratus GN=CY... [more]
CP2DG_CAVPO1.404e-1323.71Cytochrome P450 2D16 OS=Cavia porcellus GN=CYP2D16... [more]
C71DI_MENSP1.404e-1326.51Cytochrome P450 71D18 OS=Mentha spicata GN=CYP71D1... [more]
C71DI_MENGR1.404e-1326.51Cytochrome P450 71D18 OS=Mentha gracilis GN=CYP71D... [more]
CP2DJ_CALJA1.833e-1326.87Cytochrome P450 2D19 OS=Callithrix jacchus GN=CYP2... [more]
CP2DE_BOVIN1.833e-1323.60Cytochrome P450 2D14 OS=Bos taurus GN=CYP2D14 PE=2... [more]
CP2C8_HUMAN1.833e-1326.48Cytochrome P450 2C8 OS=Homo sapiens GN=CYP2C8 PE=1... [more]
CP2E1_MACFA2.395e-1326.39Cytochrome P450 2E1 (Fragment) OS=Macaca fascicula... [more]
CP2DS_MESAU2.395e-1321.55Cytochrome P450 2D28 OS=Mesocricetus auratus GN=CY... [more]
CP241_CANFA2.395e-1326.13Cytochrome P450 2C41 OS=Canis familiaris GN=CYP2C4... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34101B09EF PostHarvP1 Citrus clementina cDNA clone C34101B09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC931077 ID=FC931077|Name=FC931077|organism=Citrus clementina|type=EST|length=704bp
GCTTATGATGTACAACAACATGTACAGGATTATGTTTGATAGAAGATTCG
AGAGTCAGGATGATCCTTTGTTTAACAGATTAAAGGCTTTGAATGGTGAG
AGGAGTCGGTTGGCCCAGAGCTTTGAGTACAATTACGGTGATTTTATTCC
CATTTTGAGACCTTTCTTGAGAGGCTACTTGAAGATTTGTAAGGAAGTTA
AAGAAAGGAGACTCCAGCTCTTCAAGGACTACTTTGTTGAGGAGAGAAAG
AAATTGGCAAGCACGAAGAGCATGAGTAATGAAAGCTTGAAATGCGCAAT
CGATCATATTTTGGACGCTCAGACAAAGGGAGAAATCAACGAGGACAACG
TTCTATACATCGTTGAGAACATCAATGTTGCCGCGATCGAGACAACTCTT
TGGTCGATCGAGTGGGGAATTGCAGAGCTAGTGAATCATCCTGAAATCCA
GAAGAAGCTCCGCAATGAACTTGACACCGTGCTTGGTCCTGGTCATCAAA
TCACTGAGCCTGACACCCACAAACTACCCTACCTTCAGGCCGTGATCAAG
GAAACTCTTCGCCTTAGGATGGCAATTCCTCTTCTTGTGCCGCACATGAA
CCTTCACGACGCCAAGCTTGGAGGCTACGACGTCCCTGCTGAGAGCAAAA
TCCTAGTGAACGCGTGGTGGCTCGCCAACNATCCCGCCCCATGGAAGAAA
CCTG
back to top